Gene Information

Name : ureA (PSYCG_05175)
Accession : YP_008162907.1
Strain : Psychrobacter sp. G
Genome accession: NC_021661
Putative virulence/resistance : Virulence
Product : urease subunit gamma
Function : -
COG functional category : -
COG ID : -
EC number : 3.5.1.5
Position : 1145478 - 1145780 bp
Length : 303 bp
Strand : -
Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter; Derived by automated computational analysis usi

DNA sequence :
ATGCAATTAAATCCTACCGAAAAAGATAAACTCTTACTATTTACAGCCGGTATGGTAGCGGAACGTCGTAAAAATCGTGG
CGTCAAGCTCAATTATCCTGAGTCTATCGCTTACATTAGCATGTTACTAATGGAAGGCGCGCGTGATGGCAAAACCGTGG
CGCAACTGATGAGTGAAGGAGCCACTTATCTCTCTGCCGATGACGTCATGGAAGGCATCGCAGAGATGATACATGATGTC
CAAGTTGAAGCCACTTTCCCCGATGGCACTAAGCTGGTGACGGTACATAACCCCATCGTATAA

Protein sequence :
MQLNPTEKDKLLLFTAGMVAERRKNRGVKLNYPESIAYISMLLMEGARDGKTVAQLMSEGATYLSADDVMEGIAEMIHDV
QVEATFPDGTKLVTVHNPIV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ureA NP_286678.1 urease subunit gamma Virulence TAI Protein 1e-25 72
ureA NP_287086.1 urease subunit gamma Not tested TAI Protein 1e-25 72
ureA YP_005684268.1 urease subunit gamma Not tested PiCp 7 Protein 2e-29 70
ureA YP_003784327.1 urease subunit gamma Not tested PiCp 7 Protein 2e-29 70
ureA YP_005686360.1 urease subunit gamma Not tested PiCp 7 Protein 2e-29 70
ureA YP_005682176.1 urease subunit gamma Not tested PiCp 7 Protein 2e-29 70