Gene Information

Name : PSYCG_04335 (PSYCG_04335)
Accession : YP_008162740.1
Strain : Psychrobacter sp. G
Genome accession: NC_021661
Putative virulence/resistance : Resistance
Product : chemical-damaging agent resistance protein C
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 940185 - 940760 bp
Length : 576 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGGCATTATCTCTAAACAAAGGCGGTAATTTATCGCTAACCAAAACGGATCCAAACTTAACTAAGCTGCTTATTGGTCT
TGGTTGGGATGAGCGCGCAACTTCTGGTGCCGAATTCGATCTTGATGCAAGTGTATTCTTATTAAATGCAGCTGGCAAAG
TACGCGGCGACCATGACTTTATCTTTTATAACCAACTCAAATCTGACAATGGTGCCGTTGAGCATACTGGTGATAACCGT
ACAGGCGAAGGCGACGGTGATGACGAAGTGGTCAAAGTCAACCTAACGCAAGTACCTGCCGATGTCGACAAAATCGTTGT
GACAGTCACTATTCATGATGCAGCGGCTCGTAGCCAAAACTTCGGTCAAGTTGCTAATGCCTTTATTCGCGTTGTGAATG
AAGAAACGGGTGCTGAAGTGGTGCGTTTTGATTTAGCAGAAGACTACTCTGTTGAGACAGCAATGGTATTTGGAGAAGTC
TATCGCCACAATGCAGAATGGAAATTCCGCGCCGTTGGTCAAGGTTACTCTGGTGGCTTACAAGCGATGTGCCAGCAATA
TGGTGTCGTTATTTAA

Protein sequence :
MALSLNKGGNLSLTKTDPNLTKLLIGLGWDERATSGAEFDLDASVFLLNAAGKVRGDHDFIFYNQLKSDNGAVEHTGDNR
TGEGDGDDEVVKVNLTQVPADVDKIVVTVTIHDAAARSQNFGQVANAFIRVVNEETGAEVVRFDLAEDYSVETAMVFGEV
YRHNAEWKFRAVGQGYSGGLQAMCQQYGVVI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-68 72
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-65 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-65 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-65 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-55 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-54 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-54 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-55 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-25 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-25 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 9e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSYCG_04335 YP_008162740.1 chemical-damaging agent resistance protein C BAC0389 Protein 4e-65 67
PSYCG_04335 YP_008162740.1 chemical-damaging agent resistance protein C BAC0390 Protein 7e-59 63