Gene Information

Name : PSYCG_04325 (PSYCG_04325)
Accession : YP_008162738.1
Strain : Psychrobacter sp. G
Genome accession: NC_021661
Putative virulence/resistance : Resistance
Product : chemical-damaging agent resistance protein C
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 937787 - 938362 bp
Length : 576 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGGCTATTAGCTTAACAAAAGGCGGCAACGTAAACTTATCAAAAGAAGCGCCAGGCTTAACCAATATTACTGTCGGTCT
AGGCTGGGATCCACGCGCCACTGACGGTCAAGAGTTTGACTTGGATGCGATTGGCTTTTTGGTCAATGAAGCAGGTAAAG
TACGTAACGATCAGGACTTTATTTTCTTTAATAACCTAAAGTCAGACAATGGCGCGGTTGAGCATACTGGTGATAACCGT
ACTGGTGAAGGCGACGGCGATGATGAAAAAATCAAAATCAACCTTGCAAGCATTCCAGCTGACGTGAGCAAAGTTGCTAT
CTGTGCCATCATTTATGAAGGTCAAGCTCGTAACCAAAACTTCGGTCAAGTGGGCGACGCTTATATCCGTGTTTTGAACG
ACAATGGCGATGCTGAAATCGCTCGTTATGACCTATCAGAAGACGGTAGTACCGAAACAGCGATGATTTTTGGTGAGTTA
TATCGTCATAGTGGTGACTGGAAATTCCGCGCGGTTGGTCAAGGCTTTAGCGGTGGTCTCGGACCATTAGCGGCCTCTTA
TGGCGTCAACGTTTAA

Protein sequence :
MAISLTKGGNVNLSKEAPGLTNITVGLGWDPRATDGQEFDLDAIGFLVNEAGKVRNDQDFIFFNNLKSDNGAVEHTGDNR
TGEGDGDDEKIKINLASIPADVSKVAICAIIYEGQARNQNFGQVGDAYIRVLNDNGDAEIARYDLSEDGSTETAMIFGEL
YRHSGDWKFRAVGQGFSGGLGPLAASYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-64 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-59 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-63 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-63 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 63
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-59 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-62 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSYCG_04325 YP_008162738.1 chemical-damaging agent resistance protein C BAC0389 Protein 1e-62 64
PSYCG_04325 YP_008162738.1 chemical-damaging agent resistance protein C BAC0390 Protein 1e-59 62