Gene Information

Name : PSYCG_04315 (PSYCG_04315)
Accession : YP_008162736.1
Strain : Psychrobacter sp. G
Genome accession: NC_021661
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerZ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 936166 - 936774 bp
Length : 609 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGGCAGTTAGTTTACAAAAGGGTCAAAAAATCTCCCTAAGCAAAGAAGCGGGCGGCGAGCTTACTCAAGTAAAATTGGG
TTTAGGCTGGGACGTTGCCCAAGGTCCACAAGATAAAAAAGGTGGATTCTTAGGTAAATTATTCGGTGGTGGTAGTGGCG
GCGATTCTATCGATTTAGATGCATCATGCATTATGTTCGATAGCAACAAACAGCCAGTTGATGCCATTTGGTTTAGCCAA
TTAAAATCGAAAGACGGCAGTATCGTGCACACTGGTGATAACCGCACTGGTGACGGCGATGGTGATGATGAAGTAATCAA
TGTTGATTTATCAAAAGTTCCAGCTAACGTAGTATCCTTGGTATTTACCGTCAACAGCTTTACTGGTCAGACGTTTGAGA
CAGTAGAAAATGCGTTTTGCCGTATCGTCAATGCCAATAACAATACTGAAGTAGCACGCTATAATCTGTCCTCACAAGGT
ACGCATACGGCGATGATTATGGCAAAAGTTTATCGTCATAATAATGAGTGGAAGATGCATGCCATCGGTGAAACGGCGAC
TGGTCGCACTTTCCATGACTTAATGCCTGCTATCACCCCGCATGCTTAA

Protein sequence :
MAVSLQKGQKISLSKEAGGELTQVKLGLGWDVAQGPQDKKGGFLGKLFGGGSGGDSIDLDASCIMFDSNKQPVDAIWFSQ
LKSKDGSIVHTGDNRTGDGDGDDEVINVDLSKVPANVVSLVFTVNSFTGQTFETVENAFCRIVNANNNTEVARYNLSSQG
THTAMIMAKVYRHNNEWKMHAIGETATGRTFHDLMPAITPHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-42 55
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-35 48
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-35 48
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-28 46
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-22 42
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-23 42
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-24 42
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSYCG_04315 YP_008162736.1 tellurium resistance protein TerZ BAC0392 Protein 3e-35 48
PSYCG_04315 YP_008162736.1 tellurium resistance protein TerZ BAC0389 Protein 8e-24 42