Gene Information

Name : rpmE2 (PSYCG_11930)
Accession : YP_008164242.1
Strain : Psychrobacter sp. G
Genome accession: NC_021661
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L31
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2746052 - 2746333 bp
Length : 282 bp
Strand : -
Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g

DNA sequence :
ATGCGTAAAGATATCCATCCTAATTACCAAGAAGTTTTATTCCACGACACTAACGCTGACGTGTTCTTCTTGACTCGTTC
AACTGTTAAAACCAAAACCACTCGTGAATACGAAGGTTCAGAATATCCATACTACCCACTTGATATCTCAAGTGCGTCGC
ATCCATTCTATACTGGTGAGCAACGTAAAACTTCTACTGAAGGTCGTGTTGCAAGCTTCAACAAACGTTTTGGTGCGTTT
GGTGGCCGTAAGAAAGCTGCTGATACTGACGCTGCAGAATAA

Protein sequence :
MRKDIHPNYQEVLFHDTNADVFFLTRSTVKTKTTREYEGSEYPYYPLDISSASHPFYTGEQRKTSTEGRVASFNKRFGAF
GGRKKAADTDAAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmE2 NP_287095.1 50S ribosomal protein L31 Not tested TAI Protein 4e-17 50
rpmE2 NP_286687.1 50S ribosomal protein L31 Not tested TAI Protein 4e-17 50