|
Name : rpmE2 (PSYCG_11930) Accession : YP_008164242.1 Strain : Psychrobacter sp. G Genome accession: NC_021661 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : - COG ID : - EC number : - Position : 2746052 - 2746333 bp Length : 282 bp Strand : - Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGCGTAAAGATATCCATCCTAATTACCAAGAAGTTTTATTCCACGACACTAACGCTGACGTGTTCTTCTTGACTCGTTC AACTGTTAAAACCAAAACCACTCGTGAATACGAAGGTTCAGAATATCCATACTACCCACTTGATATCTCAAGTGCGTCGC ATCCATTCTATACTGGTGAGCAACGTAAAACTTCTACTGAAGGTCGTGTTGCAAGCTTCAACAAACGTTTTGGTGCGTTT GGTGGCCGTAAGAAAGCTGCTGATACTGACGCTGCAGAATAA Protein sequence : MRKDIHPNYQEVLFHDTNADVFFLTRSTVKTKTTREYEGSEYPYYPLDISSASHPFYTGEQRKTSTEGRVASFNKRFGAF GGRKKAADTDAAE |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 4e-17 | 50 |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 4e-17 | 50 |
