Gene Information

Name : M621_19650 (M621_19650)
Accession : YP_008160700.1
Strain : Serratia plymuthica S13
Genome accession: NC_021659
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4147131 - 4147481 bp
Length : 351 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
TTGTTGAATAAAACACCGACAGCAAGCAACCACACGAAAGCGCCTTGGTGGGGACTGAAACGCGATATCACCCCGTGCTT
TGGCGTACGACTGGTCCATGAGGGCAACCGCCTGCATTACCTGGCTGACCGTGCCAGCATCGCTGGGACATTCAATGATG
CAGAGTTATGCCATCTGGGCCAGGACTTTCCGGTACTGATGAAACAGATGGAACTAATGCTCACCAGCGGCGAACTTAAT
CCTCGCTACCAACACAGCGTCACACTGTATGAAAAGGGGCTGACATGCGAGGCGTATACTCTTGGTTCGTATGGCTACGT
CTATATCGTCATCTACCCCACGAAACGTTAA

Protein sequence :
MLNKTPTASNHTKAPWWGLKRDITPCFGVRLVHEGNRLHYLADRASIAGTFNDAELCHLGQDFPVLMKQMELMLTSGELN
PRYQHSVTLYEKGLTCEAYTLGSYGYVYIVIYPTKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-35 69
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 9e-36 69
unnamed AAL57576.1 unknown Not tested LEE Protein 6e-36 69
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 7e-35 68
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 5e-34 68
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 3e-35 68
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 3e-35 68
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 2e-35 68
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-35 68
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-35 68
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 4e-34 67
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 7e-35 67
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 5e-34 67
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 9e-35 66
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 7e-35 66
Z1220 NP_286755.1 structural protein Not tested TAI Protein 1e-34 66
Z1658 NP_287161.1 structural protein Not tested TAI Protein 1e-34 66
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 8e-35 66
unnamed AAL08477.1 unknown Not tested SRL Protein 3e-34 65

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M621_19650 YP_008160700.1 hypothetical protein VFG1681 Protein 2e-34 68
M621_19650 YP_008160700.1 hypothetical protein VFG1619 Protein 3e-35 68
M621_19650 YP_008160700.1 hypothetical protein VFG0662 Protein 8e-36 68
M621_19650 YP_008160700.1 hypothetical protein VFG1068 Protein 1e-34 65