Gene Information

Name : SCE1572_11710 (SCE1572_11710)
Accession : YP_008148786.1
Strain : Sorangium cellulosum So0157-2
Genome accession: NC_021658
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3228915 - 3229901 bp
Length : 987 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGCAAGACCACCCCCGATCCTCACGCCGCGGCTTCCTCGGTGGAGCCGCCTCCGTCCTTCTCCTCGGCTGCGCAGGAGC
GCAGCAGCCGCAACCGGCCGGCGCCGGAGCCTCGAGCGCGGCCCCGGCGACGACCTCCCCGGCGGCGGCGGGCGCGCAGG
CCGCCGCCTCGCCAGCGCCCTCGCCCGGGCCGGGCGCGCAGGCCGCGCCGGCCCTCGCGCGCATCGAAGCGCAGGTCGGC
GGCCGCCTCGGCGTGGCCGCCCTCGACACGGCGACCGGCGCGCGCATCGGTCACCGCGCCGCCGAGCGCTTCGCGATGTG
CTCCACCTTCAAGACGCTCCTCGCGGCGTGCATCCTCGCGCGCGTCGACCAGGGCCAGCTCAGGCTGGATCACCGCGTCA
CCTACCGTGCGTCCGATCTGCTCGATCACGCGCCGGTCACGCGCGCCCACCTCGCGCAGGGCAGCCTGACCGTCGAGGAG
CTCTGCGCCGCCGTCGTCGAGATCAGCGACAACACGGCCGCCAACCTGCTCCTCGCGCAGATCGGCGGCCCCGCCGGCCT
CACCGCCTACCTCCGCGGCCTCGGCGACCCGGTGACGCGCCTCGATCGCAACGAGCTGGCCCTCAACGAGAACGTGCCCG
GCGATCCCCGCGACACGTCGACCCCCGACGCCATGACCGATACGGTTCGCGCCATCCTGGTCGGCGATCGCGCGCTCCAG
CGGGCGTCGCGCGAGCGCCTCGCCTCGTGGATGGTCCGGTCGACCACCGGCTTCGCCCGCCTCCGGGCGGGCCTGCCGAA
GGACTGGGTCATCGGCGACAAGACCGGGACCGGCATCGGCATCGCGAACGACGTCGCGGTCGCGTGGCCCCCGTCGCGCG
CGCCCATCGTCATCGCGTGCTTCGTCGACGCGCCGTCGGCGAGCGCCGACGCGCGCAACGCCGCGCACGCCGACGTCGCC
CGCGTCGTCGCCGAGGCGTTCGGCTGA

Protein sequence :
MQDHPRSSRRGFLGGAASVLLLGCAGAQQPQPAGAGASSAAPATTSPAAAGAQAAASPAPSPGPGAQAAPALARIEAQVG
GRLGVAALDTATGARIGHRAAERFAMCSTFKTLLAACILARVDQGQLRLDHRVTYRASDLLDHAPVTRAHLAQGSLTVEE
LCAAVVEISDNTAANLLLAQIGGPAGLTAYLRGLGDPVTRLDRNELALNENVPGDPRDTSTPDAMTDTVRAILVGDRALQ
RASRERLASWMVRSTTGFARLRAGLPKDWVIGDKTGTGIGIANDVAVAWPPSRAPIVIACFVDAPSASADARNAAHADVA
RVVAEAFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaCTX-M2 ACF06162.1 beta-lactamase CTX-M2 Not tested Tn5036-like Protein 7e-47 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCE1572_11710 YP_008148786.1 hypothetical protein FJ234412.1.gene1.p01 Protein 9e-49 49
SCE1572_11710 YP_008148786.1 hypothetical protein AY034847.1.gene1.p01 Protein 6e-48 49
SCE1572_11710 YP_008148786.1 hypothetical protein HM066995.1.gene1.p01 Protein 1e-47 49
SCE1572_11710 YP_008148786.1 hypothetical protein AF395881.gene.p01 Protein 5e-48 49
SCE1572_11710 YP_008148786.1 hypothetical protein EU555534.1.gene1.p01 Protein 1e-48 49
SCE1572_11710 YP_008148786.1 hypothetical protein GQ140348.1.gene1.p01 Protein 6e-48 49
SCE1572_11710 YP_008148786.1 hypothetical protein HQ641421.1.gene1.p01 Protein 9e-48 49
SCE1572_11710 YP_008148786.1 hypothetical protein AF297554.1.gene1.p1 Protein 1e-47 49
SCE1572_11710 YP_008148786.1 hypothetical protein EU729727.1.gene1.p1 Protein 7e-48 49
SCE1572_11710 YP_008148786.1 hypothetical protein DQ408762.1.gene1.p1 Protein 5e-48 49
SCE1572_11710 YP_008148786.1 hypothetical protein DQ328639.gene.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY005110.1.gene1.p1 Protein 4e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AB205197.1.gene1.p01 Protein 4e-45 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY750914.gene.p01 Protein 4e-45 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY080894.1.gene1.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ256091.1.gene1.p1 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein GQ149243.1.gene1.p01 Protein 3e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ125241.gene.p01 Protein 4e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AF255298.1.gene1.p1 Protein 6e-48 48
SCE1572_11710 YP_008148786.1 hypothetical protein AF305837.gene.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein EU402393.1.gene1.p1 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein JF274247.1.gene1.p01 Protein 6e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY157676.1.gene1.p01 Protein 3e-44 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY292654.1.gene1.p1 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AF488377.1.gene1.p1 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AB284167.2.gene1.p01 Protein 3e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein HM776707.1.gene1.p1 Protein 4e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein Y10278.1.gene1.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein GU127598.1.gene1.p1 Protein 5e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY238472.1.gene1.p01 Protein 9e-48 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY822595.1.gene1.p01 Protein 4e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AF189721.1.gene1.p01 Protein 1e-45 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY995206.gene.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ223685.1.gene1.p01 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ102702.1.gene1.p1 Protein 5e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AM982522.2.gene1.p01 Protein 8e-45 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ061159.1.gene1.p01 Protein 9e-48 48
SCE1572_11710 YP_008148786.1 hypothetical protein EU177100.1.gene1.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ885477.1.gene1.p01 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY515297.1.gene1.p1 Protein 3e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AJ549244.1.gene1.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein EF426798.1.gene1.p1 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein EF374097.1.gene1.p01 Protein 4e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein HQ398215.1.gene1.p01 Protein 6e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein FJ873739.1.gene1.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein X92507.1.gene1.p01 Protein 4e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY598759.gene.p01 Protein 6e-48 48
SCE1572_11710 YP_008148786.1 hypothetical protein AJ704396.1.gene1.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AJ567481.1.gene1.p01 Protein 6e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY267213.1.gene1.p01 Protein 9e-48 48
SCE1572_11710 YP_008148786.1 hypothetical protein GQ351346.1.gene1.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein HQ398214.1.gene1.p01 Protein 3e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein GQ149244.1.gene1.p01 Protein 4e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein U95364.1.gene1.p01 Protein 1e-46 48
SCE1572_11710 YP_008148786.1 hypothetical protein AB177384.1.gene1.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein JF966749.1.gene1.p01 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein JN227085.1.gene1.p01 Protein 5e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ810789.1.gene1.p01 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AJ416344.1.gene1.p01 Protein 4e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY847148.1.gene1.p01 Protein 1e-46 48
SCE1572_11710 YP_008148786.1 hypothetical protein AY649755.1.gene1.p01 Protein 5e-48 48
SCE1572_11710 YP_008148786.1 hypothetical protein EU202673.2.gene1.p2 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein FJ815436.1.gene1.p01 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ268764.2.gene6.p01 Protein 1e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein AM411407.1.gene1.p01 Protein 2e-47 48
SCE1572_11710 YP_008148786.1 hypothetical protein DQ663489.gene.p01 Protein 3e-47 47
SCE1572_11710 YP_008148786.1 hypothetical protein HQ913565.1.gene1.p01 Protein 3e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein HQ833651.1.gene1.p01 Protein 1e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY143430.1.gene1.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein DQ211987.1.gene1.p01 Protein 8e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY954516.1.gene1.p1 Protein 1e-43 47
SCE1572_11710 YP_008148786.1 hypothetical protein AF325134.1.gene1.p1 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein EF418608.1.gene1.p01 Protein 3e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein FJ214367.1.gene1.p1 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein FJ214369.1.gene1.p1 Protein 6e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein FJ214366.1.gene1.p1 Protein 1e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein HM755448.1.gene1.p01 Protein 3e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein EF219142.1.gene1.p01 Protein 2e-47 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY033516.1.gene2.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein JF274246.1.gene1.p01 Protein 5e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein EF581888.1.gene1.p01 Protein 1e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein FJ907381.1.gene1.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein FJ971899.1.gene1.p1 Protein 2e-43 47
SCE1572_11710 YP_008148786.1 hypothetical protein AF325133.1.gene1.p1 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AF174129.3.gene9.p01 Protein 5e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY847146.1.gene1.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein HQ166709.1.gene1.p01 Protein 1e-45 47
SCE1572_11710 YP_008148786.1 hypothetical protein GQ870432.1.gene1.p1 Protein 1e-43 47
SCE1572_11710 YP_008148786.1 hypothetical protein HQ833652.1.gene1.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY029068.1.gene1.p1 Protein 4e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AJ557142.gene.p01 Protein 2e-47 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY847147.1.gene1.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein JF274243.1.gene1.p01 Protein 7e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein HM167760.1.gene1.p01 Protein 5e-44 47
SCE1572_11710 YP_008148786.1 hypothetical protein EF210159.1.gene1.p01 Protein 1e-47 47
SCE1572_11710 YP_008148786.1 hypothetical protein EU545409.1.gene1.p1 Protein 3e-47 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY156923.1.gene1.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein FJ214368.1.gene1.p1 Protein 3e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein X92506.gene.p01 Protein 2e-47 47
SCE1572_11710 YP_008148786.1 hypothetical protein HM803271.1.gene1.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein Y14156.1.gene1.p01 Protein 5e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY847143.1.gene1.p01 Protein 1e-45 47
SCE1572_11710 YP_008148786.1 hypothetical protein DQ023162.1.gene1.p1 Protein 2e-43 47
SCE1572_11710 YP_008148786.1 hypothetical protein AF252622.2.gene2.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AF252623.2.gene1.p01 Protein 5e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein EU136031.3.gene1.p3 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AJ005045.gene.p01 Protein 1e-45 47
SCE1572_11710 YP_008148786.1 hypothetical protein AF518567.2.gene4.p01 Protein 2e-43 47
SCE1572_11710 YP_008148786.1 hypothetical protein AY847144.1.gene1.p01 Protein 2e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AJ416345.gene.p01 Protein 5e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein JF274242.1.gene1.p01 Protein 1e-46 47
SCE1572_11710 YP_008148786.1 hypothetical protein AF104442.1.gene1.p01 Protein 2e-42 46
SCE1572_11710 YP_008148786.1 hypothetical protein AY303807.gene.p01 Protein 7e-43 46
SCE1572_11710 YP_008148786.1 hypothetical protein AY847145.1.gene1.p01 Protein 2e-45 46
SCE1572_11710 YP_008148786.1 hypothetical protein AF135373.1.gene1.p01 Protein 1e-44 46
SCE1572_11710 YP_008148786.1 hypothetical protein AY178993.1.gene1.p01 Protein 1e-44 46
SCE1572_11710 YP_008148786.1 hypothetical protein U50278.1.gene2.p01 Protein 1e-44 43
SCE1572_11710 YP_008148786.1 hypothetical protein AF275256.gene.p01 Protein 3e-45 42
SCE1572_11710 YP_008148786.1 hypothetical protein Z28968.gene.p01 Protein 2e-45 42