Gene Information

Name : yclJ (SOD_c13880)
Accession : YP_008137579.1
Strain : Serratia odorifera 4Rx13
Genome accession: NC_021591
Putative virulence/resistance : Virulence
Product : putative transcriptional regulatory protein YclJ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1504971 - 1505684 bp
Length : 714 bp
Strand : -
Note : -

DNA sequence :
ATGGAAAAACCAAAGAGAATTTTAATCGTTGAGGATGACGGCGACATCGCCGAACTGTTGCAGTTGCACCTGCGCGATGA
AGGCTACGACATTAGCCACGCCGCCGACGGCAATCAGGGCATGGCGATGCTGGAACAGGGCGGCTGGGACGCGCTGATCC
TCGATCTGATGCTGCCGGGCGTCGATGGGCTGGAGATCTGCCGCCGGGCGCGCAACATGACGCGCTACACGCCGATCATC
ATCATCAGCGCGCGCTCCAGCGAGGTGCACCGCGTGCTGGGGCTGGAGCTGGGTGCCGACGATTACCTGGCCAAACCCTT
CTCGATGCTGGAACTGGTGGCGCGGGTCAAAGCGCTGTTCCGCCGCCAGGAGGCGATGAGCCGCAACCTGCGTATGGACG
CCGGCACGCTGAGCTTTGACGGATTGACCATAGACCCCATAGCCCGCGAAGTGCAGCTGAATCGGCAACCGATAGATCTG
ACGCCGCGCGAGTTTGACCTGCTGTATTTCTTCGCTCGCCATCCGGGCAAGGTGTTCTCCCGCCTTAGCCTGTTGAACCA
GGTGTGGGGCTATCAGCACGAGGGGTATGAACACACGGTGAATACCCATATCAACCGGCTGCGCATCAAGATAGAAAGCA
ACCCGGCGGAACCCCTGCGCATCCTCACGGTGTGGGGGATGGGCTATAAATTCGCGGCCCCGCCGCAAGAGTAA

Protein sequence :
MEKPKRILIVEDDGDIAELLQLHLRDEGYDISHAADGNQGMAMLEQGGWDALILDLMLPGVDGLEICRRARNMTRYTPII
IISARSSEVHRVLGLELGADDYLAKPFSMLELVARVKALFRRQEAMSRNLRMDAGTLSFDGLTIDPIAREVQLNRQPIDL
TPREFDLLYFFARHPGKVFSRLSLLNQVWGYQHEGYEHTVNTHINRLRIKIESNPAEPLRILTVWGMGYKFAAPPQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-76 67
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-76 67

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ AE000516.2.gene3505. Protein 6e-40 45
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ HE999704.1.gene1528. Protein 1e-35 43
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_012469.1.7685629. Protein 5e-41 43
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_007622.3794948.p0 Protein 4e-36 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_003923.1003417.p0 Protein 4e-36 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_013450.8614146.p0 Protein 4e-36 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_002951.3238224.p0 Protein 4e-36 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_007793.3914065.p0 Protein 4e-36 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_002758.1121390.p0 Protein 4e-36 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_010079.5776364.p0 Protein 4e-36 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_002952.2859858.p0 Protein 4e-36 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ AE015929.1.gene1106. Protein 1e-31 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ AF155139.2.orf0.gene Protein 3e-43 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ FJ349556.1.orf0.gene Protein 5e-40 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ AE016830.1.gene1681. Protein 1e-45 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_012469.1.7686381. Protein 7e-42 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ HE999704.1.gene2815. Protein 4e-41 42
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ BAC0039 Protein 3e-32 41
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ BAC0596 Protein 9e-32 41
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ CP000034.1.gene2186. Protein 3e-32 41
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ NC_002695.1.916589.p Protein 3e-32 41
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ CP001138.1.gene2239. Protein 9e-32 41
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ CP001918.1.gene3444. Protein 3e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ VFG1563 Protein 7e-77 67
yclJ YP_008137579.1 putative transcriptional regulatory protein YclJ VFG1702 Protein 6e-77 67