Name : SOD_c10120 (SOD_c10120) Accession : YP_008137213.1 Strain : Serratia odorifera 4Rx13 Genome accession: NC_021591 Putative virulence/resistance : Virulence Product : transcriptional regulatory protein Function : - COG functional category : - COG ID : - EC number : - Position : 1117118 - 1117324 bp Length : 207 bp Strand : - Note : - DNA sequence : ATGACGAACGAATACCCCCTACTCAGTGACAAATTTGTTGATATGGCCTTTATCACCAACCTGACGGGCCTGACGAATAA GTGGTTCTACAAACTGATAAAAGACGGAGACTTTCCGAAACCTATAAAGCTAGGGCGAAGCTCCCGCTGGCTGCAAAGCG AAGTTCACGTCTGGCTGCAACGTCGTATCGAAGAATCCCGTGCGTAG Protein sequence : MTNEYPLLSDKFVDMAFITNLTGLTNKWFYKLIKDGDFPKPIKLGRSSRWLQSEVHVWLQRRIEESRA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 2e-20 | 73 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 5e-20 | 71 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 5e-20 | 71 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 9e-20 | 68 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 1e-19 | 68 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-19 | 68 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-19 | 68 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 3e-17 | 67 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 4e-17 | 67 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 1e-19 | 67 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 3e-13 | 64 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 3e-13 | 64 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
SOD_c10120 | YP_008137213.1 | transcriptional regulatory protein | VFG0651 | Protein | 4e-20 | 68 |
SOD_c10120 | YP_008137213.1 | transcriptional regulatory protein | VFG1480 | Protein | 1e-17 | 67 |
SOD_c10120 | YP_008137213.1 | transcriptional regulatory protein | VFG1057 | Protein | 5e-20 | 67 |