Gene Information

Name : ssaR (M062_09005)
Accession : YP_008132244.1
Strain : Pseudomonas aeruginosa RP73
Genome accession: NC_021577
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliP
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1901596 - 1902249 bp
Length : 654 bp
Strand : -
Note : part of a set of proteins involved in the infection of eukaryotic cells; in plant pathogens involved in the hypersensitivity response; Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence : 
ATGATCCAGTTGCCCGACGAGCTCGGCCTGATCCTCGGCCTGGCCCTGCTCGCGCTGGTCCCGTTCATCGCGGTGATGGC
GACCTCCTTCATCAAGATGACCGTGGTCTTCTCGCTGCTGCGCAACGCTCTGGGCGTCCAGCAGATTCCGCCGAACATGG
CGATGTACGGGCTGGCGATCATCCTCAGCCTGTACGTGATGGCACCGGTCGGCTTCGCCACCCGCGACTACCTGCGCAAC
CACGACGTCAGCCTGAGCGACTCGGCATCGGTGGAACGCTTTCTCGACGAGGGCATGGCGCCCTACCGGAACTTCCTCAA
GCGGCAGATCCAGGAGCGCGAACACACCTTCTTCATGGAAAGCACCCGCCAGGTCTGGCCCAGCGAATACGCCGAGCGGC
TCGACCCGGACAGCCTGCTGATCCTGCTGCCGGCCTTCACCGTCAGCGAACTGACCCGTGCCTTCGAGATCGGCTTCCTG
ATCTACCTGCCCTTCATCGCCATCGATCTGATCATCTCCAACATCCTCCTGGCGATGGGCATGATGATGGTGTCGCCGAT
GACCATTTCCCTGCCGTTCAAGCTGCTCCTGTTCGTCCTCCTCGACGGCTGGGCGCGGCTGACCCACGGCCTGGTCATCA
GCTACGGAGGCTGA

Protein sequence : 
MIQLPDELGLILGLALLALVPFIAVMATSFIKMTVVFSLLRNALGVQQIPPNMAMYGLAIILSLYVMAPVGFATRDYLRN
HDVSLSDSASVERFLDEGMAPYRNFLKRQIQEREHTFFMESTRQVWPSEYAERLDPDSLLILLPAFTVSELTRAFEIGFL
IYLPFIAIDLIISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWARLTHGLVISYGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lscR AAO18040.1 LscR Virulence TTSS locus Protein 1e-72 83
ssaR YP_216427.1 type III secretion system protein Virulence SPI-2 Protein 3e-45 56
ssaR NP_460384.1 type III secretion system protein Virulence SPI-2 Protein 3e-45 56
ssaR CAA68199.1 secretion system apparatus, SsaR Virulence SPI-2 Protein 2e-45 56
YPO0270 YP_002345352.1 type III secretion system protein Virulence Not named Protein 3e-47 56
yscR NP_456109.1 putative type III secretion protein Virulence SPI-2 Protein 1e-44 55
yscR NP_805090.1 type III secretion system protein Virulence SPI-2 Protein 1e-44 55
hrcR BAB07862.1 HrcR Virulence Hrp PAI Protein 2e-41 53
hrcR AAP34349.1 HrcR Virulence Hrp PAI Protein 9e-42 53
hrcR YP_362153.1 type III secretion system protein Virulence Hrp PAI Protein 8e-42 51
XC_3016 YP_244084.1 type III secretion system protein Virulence Hrp PAI Protein 9e-42 51
hrcR AAD21321.1 HrcR Virulence Hrp PAI Protein 6e-42 51
hrcR NP_636600.1 type III secretion system protein Virulence Hrp PAI Protein 9e-42 51
hrcR NP_640757.1 type III secretion system protein Virulence Hrp PAI Protein 8e-42 51
hrcR YP_198720.1 type III secretion system protein Virulence Hrp PAI Protein 1e-41 51
hrcR AAT96262.1 HrcR Virulence S-PAI Protein 5e-36 50
hrcR AAT96303.1 HrcR Virulence S-PAI Protein 5e-36 50
hrcR AAT96343.1 HrcR Virulence S-PAI Protein 5e-36 50
hrcR ABA47279.1 HrcR Virulence S-PAI Protein 4e-36 49
escR AAC31528.1 L0049 Virulence LEE Protein 1e-36 48
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 2e-36 48
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 1e-36 48
unnamed AAL06354.1 EscR Virulence LEE Protein 6e-36 48
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 2e-36 48
escR AAK26700.1 EscR Virulence LEE Protein 1e-36 48
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 2e-36 48
escR AAL57527.1 EscR Virulence LEE Protein 1e-36 48
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 2e-36 48
escR CAC81847.1 EscR protein Virulence LEE II Protein 1e-36 48
escR CAI43889.1 EscR protein Virulence LEE Protein 1e-36 48
hrcR ABQ88359.1 HrcR Virulence Hrp PAI Protein 5e-38 47
hrpW AAB05075.1 HrpW Virulence Hrp PAI Protein 5e-38 47
hrcR AAT96200.1 HrcR Virulence T-PAI Protein 2e-38 47
hrcR AAT96146.1 HrcR Virulence T-PAI Protein 1e-38 47
escR AAC38369.1 EscR Virulence LEE Protein 8e-36 47
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 8e-36 47
escR AFO66317.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 9e-37 47
escR AFO66400.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 9e-37 47
hrcR NP_791222.3 type III secretion protein HrcR Virulence Hrp PAI Protein 2e-36 45
hrcR AAG33884.1 HrcR Virulence Hrp PAI Protein 1e-36 45
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 7e-36 45
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 2e-35 45
hrcR AAB06005.2 HrcR Virulence Hrp PAI Protein 4e-35 45
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 2e-36 43
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 2e-28 43
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 2e-28 43
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 6e-29 43
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 6e-29 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG0188 Protein 6e-85 100
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG0394 Protein 6e-73 80
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG0519 Protein 9e-46 56
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG0044 Protein 5e-45 54
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG0827 Protein 6e-37 48
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG0715 Protein 4e-36 47
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG1773 Protein 2e-38 45
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG1012 Protein 2e-33 43
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG0551 Protein 2e-29 43
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG2338 Protein 4e-24 43
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG2455 Protein 7e-34 42
ssaR YP_008132244.1 flagellar biosynthesis protein FliP VFG1259 Protein 7e-27 41