Gene Information

Name : PCA10_p0620 (PCA10_p0620)
Accession : YP_008116549.1
Strain :
Genome accession: NC_021506
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 54549 - 54893 bp
Length : 345 bp
Strand : +
Note : -

DNA sequence :
ATGATTGCTCCGCCCATCGGGACTCGCATTTGGATCGCTGCCGGGGTCACGGACATGCGGCGGGGGTTCGATGGCCTGGC
GGCCCTGGTGCAAACTCAGCTTGAAGCGGATCCATTCTCTGGCCAGATCTTTGTGTTTCGAGGCCGACGGGGTGACCGGA
TTAAATTGCTGTGGTGGGATGGCGATGGCTTGTGTTTGTTCTGCAAGCGGCTCGAGCAGGGGCGCTTCGTCTGGCCGCAG
GCCGCCAGCGGCAGCGTATCCTTGACGACGGCACAACTCGCGATGCTGTTGGAGGGCATCGATTGGCGCCGACCGATACG
CACCGCACCGGTACGAACGGTCTGA

Protein sequence :
MIAPPIGTRIWIAAGVTDMRRGFDGLAALVQTQLEADPFSGQIFVFRGRRGDRIKLLWWDGDGLCLFCKRLEQGRFVWPQ
AASGSVSLTTAQLAMLLEGIDWRRPIRTAPVRTV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-32 68
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-32 68
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-32 68
unnamed AAL08461.1 unknown Not tested SRL Protein 7e-32 68
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-32 68
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-32 68
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-32 68
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-32 68
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-32 68
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-32 68
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-32 68
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-32 68
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-32 68
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-34 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-34 67
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-31 67
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-31 67
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-33 66
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-24 65
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-31 65
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-32 63
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-32 63
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-32 61
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-30 61
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-30 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCA10_p0620 YP_008116549.1 putative transposase VFG0792 Protein 2e-32 68
PCA10_p0620 YP_008116549.1 putative transposase VFG1698 Protein 1e-32 68
PCA10_p0620 YP_008116549.1 putative transposase VFG1709 Protein 2e-32 68
PCA10_p0620 YP_008116549.1 putative transposase VFG1052 Protein 3e-32 68
PCA10_p0620 YP_008116549.1 putative transposase VFG1665 Protein 4e-34 66
PCA10_p0620 YP_008116549.1 putative transposase VFG1517 Protein 6e-25 65
PCA10_p0620 YP_008116549.1 putative transposase VFG1737 Protein 2e-32 61