Gene Information

Name : czrR (PP4_00210)
Accession : YP_008111058.1
Strain : Pseudomonas putida NBRC 14164
Genome accession: NC_021505
Putative virulence/resistance : Virulence
Product : two-component response regulator CzrR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 23758 - 24432 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGCGTTCTAGTTGTGGAAGACGAAATTAAAACTGCCGAATATCTTCAGCAGGGCCTATCCGAAAGCGGGTATGTCGT
AGATATCGTGCACAACGGTGTAGATGCTCTGCACTTGTTCAACACTAATGTCTATTCGTTGGTCCTCCTGGACGTGAACC
TCCCGGGTATCGACGGCTGGGACCTGCTGGAAACCATCCGTAAGACCAGCCGGGTCCGCATCATCATGCTGACCGCCCGC
GGACGCATCAATGACAAGCTCAAGGGCTTGGACGGCGGCGCGGATGACTACCTTGTGAAGCCATTCGAATTCCCTGAGCT
GCTTGCTCGCATCCGTTCGCTGCAACGCCGTGGTGATGAGTTAGTCGAGAAGAGCTCGCTGAAAATTGCCGATCTGGAAC
TCGACTCCGTCCGCCATCGCGTCTTCCGCGGTGGCACACGCATCGATCTCACCACCAAGGAATTTGCGCTTCTGCACCTG
CTCATGAGCCGAACGGGCGAAGCGCTGACTCGCTCTCAGATCATCTCGTTGGTCTGGGATATGAATTTCGATTGCGACAC
CAATGTCATCGATGTAGCCATCCGGCGCTTGCGCTCGAAGATCGATGACCCGTTTGAAACCAAGCTCATTCACACGCTTC
GTGGCGTTGGGTACGTTTTTGAGGAACGCGCATGA

Protein sequence :
MRVLVVEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTNVYSLVLLDVNLPGIDGWDLLETIRKTSRVRIIMLTAR
GRINDKLKGLDGGADDYLVKPFEFPELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHL
LMSRTGEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDDPFETKLIHTLRGVGYVFEERA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-49 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-48 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR YP_008111058.1 two-component response regulator CzrR BAC0125 Protein 1e-57 60
czrR YP_008111058.1 two-component response regulator CzrR BAC0197 Protein 3e-55 58
czrR YP_008111058.1 two-component response regulator CzrR BAC0083 Protein 3e-54 57
czrR YP_008111058.1 two-component response regulator CzrR BAC0638 Protein 6e-50 57
czrR YP_008111058.1 two-component response regulator CzrR BAC0308 Protein 2e-51 56
czrR YP_008111058.1 two-component response regulator CzrR BAC0111 Protein 2e-54 55
czrR YP_008111058.1 two-component response regulator CzrR BAC0347 Protein 5e-50 52
czrR YP_008111058.1 two-component response regulator CzrR NC_007622.3794948.p0 Protein 3e-30 41
czrR YP_008111058.1 two-component response regulator CzrR NC_003923.1003417.p0 Protein 3e-30 41
czrR YP_008111058.1 two-component response regulator CzrR NC_013450.8614146.p0 Protein 3e-30 41
czrR YP_008111058.1 two-component response regulator CzrR NC_002951.3238224.p0 Protein 3e-30 41
czrR YP_008111058.1 two-component response regulator CzrR NC_007793.3914065.p0 Protein 3e-30 41
czrR YP_008111058.1 two-component response regulator CzrR NC_002758.1121390.p0 Protein 3e-30 41
czrR YP_008111058.1 two-component response regulator CzrR NC_010079.5776364.p0 Protein 3e-30 41
czrR YP_008111058.1 two-component response regulator CzrR NC_002952.2859858.p0 Protein 3e-30 41
czrR YP_008111058.1 two-component response regulator CzrR AE015929.1.gene1106. Protein 2e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR YP_008111058.1 two-component response regulator CzrR VFG0596 Protein 3e-49 51
czrR YP_008111058.1 two-component response regulator CzrR VFG1390 Protein 1e-34 43