Gene Information

Name : fliQ (PP4_16700)
Accession : YP_008112707.1
Strain : Pseudomonas putida NBRC 14164
Genome accession: NC_021505
Putative virulence/resistance : Virulence
Product : flagellar biosynthetic protein FliQ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1938280 - 1938534 bp
Length : 255 bp
Strand : +
Note : -

DNA sequence :
ATGAATGACCTGGTGTTTGCCGGTAACCAAACCTTGTACCTGATATTGATCCTCGTGGCCTGGCCGATCATCGTCGCTAC
GTTGGTGGGATTGCTGATCGGTCTGTTTCAGACCGTGACCCAGCTTCAGGAGCAAACCTTGCCCTTCGGCTTCAAGCTGC
TGGCGGTGTCGATCTGTCTGTTTCTGCTTTCTGGCTGGTACGGCGAGACGCTGCTGGGCTTCAGCCGGGAAGTCATGCGT
CTGGCCCTGAAGTGA

Protein sequence :
MNDLVFAGNQTLYLILILVAWPIIVATLVGLLIGLFQTVTQLQEQTLPFGFKLLAVSICLFLLSGWYGETLLGFSREVMR
LALK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaQ AAS66866.1 SpaQ Not tested SSR-2 Protein 3e-26 78
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 2e-26 75
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 2e-26 75
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 2e-26 75
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 2e-26 75
epaQ AAZ31292.1 EpaQ Virulence ETT2 Protein 3e-23 73
ECs3724 NP_311751.1 EpaQ Not tested LIM Protein 5e-23 72
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 4e-15 55
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 6e-11 47
lscS AAO18039.1 LscS Virulence TTSS locus Protein 1e-08 47
hrcS AAT96147.1 HrcS Virulence T-PAI Protein 2e-09 46
hrcS AAT96201.1 HrcS Virulence T-PAI Protein 2e-09 46
hrcS AAG33885.1 HrcS Virulence Hrp PAI Protein 1e-09 46
hrcS NP_791221.1 type III secretion protein HrcS Virulence Hrp PAI Protein 2e-09 46
hrcS ABQ88360.1 HrcS Virulence Hrp PAI Protein 3e-06 46
hrpO AAB05076.1 HrpO Virulence Hrp PAI Protein 3e-06 46
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 2e-09 45
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 2e-09 45
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 2e-09 45
escS AAL57528.1 EscS Virulence LEE Protein 3e-06 44
escS CAC81848.1 EscS protein Virulence LEE II Protein 3e-06 44
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 4e-06 44
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 4e-06 44
escS AAK26701.1 EscS Virulence LEE Protein 3e-06 44
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 3e-09 44
unnamed AAL06355.1 EscS Virulence LEE Protein 2e-06 43
escS CAI43888.1 EscS protein Virulence LEE Protein 7e-06 43
ECs4582 NP_312609.1 EscS Virulence LEE Protein 1e-05 42
escS AAC38370.1 EscS Virulence LEE Protein 8e-06 42
escS AAC31527.1 L0048 Virulence LEE Protein 8e-06 42
escS ACU09472.1 hypothetical protein Not tested LEE Protein 8e-06 42
escS YP_003236102.1 T3SS structure protein EscS Virulence LEE Protein 1e-05 42
escS NP_290282.1 hypothetical protein Virulence LEE Protein 1e-05 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG0550 Protein 5e-27 75
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG1013 Protein 1e-21 68
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG2454 Protein 2e-16 58
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG1772 Protein 9e-19 55
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG0187 Protein 2e-04 52
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG0043 Protein 4e-07 45
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG0395 Protein 3e-10 43
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG0826 Protein 3e-06 42
fliQ YP_008112707.1 flagellar biosynthetic protein FliQ VFG0716 Protein 3e-06 42