Gene Information

Name : czrR (PP4_09880)
Accession : YP_008112025.1
Strain : Pseudomonas putida NBRC 14164
Genome accession: NC_021505
Putative virulence/resistance : Virulence
Product : two-component response regulator CzrR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1135645 - 1136319 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGCGCCTACTGATCATCGAGGACGAACTGCGTACCGCCGATTACCTGCAACAGGGCCTGCGCGAAAACGGCTACGTGGT
CGACTGCGCCCACACCGGCACCGACGGCCTGCACCTGGCCCGCCAACAGCCCTACGACCTGGTCATCCTCGACGTCAACC
TGCCTGAAATCGATGGCTGGACCGTGCTGCAGCGGCTGCGTGCCGAATCGGCCACGCGCATCATGATGCTGACCGCCCAT
GGTCGCCTGGCCGACCGGGTCAAAGGCCTGGACCTGGGCGCCGATGACTACCTGCTCAAGCCCTTCGAATTCCCTGAACT
TCTGGCGCGTATCCGCAGCCTGCTGCGCCGTAACGATCAGCAGCTGCAGCCCAGCACCCTGCGCGTCGCAGACCTGGAAC
TGGACCCCGGCCGCCACCGCGCCTACCGCGCCGGGCAGCGCATTGACCTGACCGCCAAGGAGTTCGCCCTGCTGCACCTG
CTGATGCGCCAAAGTGGTGAAGTGCTTTCGCGCACCCAGATCATCTCGTTGGTATGGGACATGAATTTCGACTGCGACAC
CAACGTGGTCGAAGTTTCGATCCGTCGCCTGCGGGCGAAGATCGACGACCCGTTCGACAACAAGCTGATCCATACCCTGC
GCGGCGTAGGCTATGTACTGGAGGCGCGCGCTTGA

Protein sequence :
MRLLIIEDELRTADYLQQGLRENGYVVDCAHTGTDGLHLARQQPYDLVILDVNLPEIDGWTVLQRLRAESATRIMMLTAH
GRLADRVKGLDLGADDYLLKPFEFPELLARIRSLLRRNDQQLQPSTLRVADLELDPGRHRAYRAGQRIDLTAKEFALLHL
LMRQSGEVLSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFDNKLIHTLRGVGYVLEARA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-55 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-55 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR YP_008112025.1 two-component response regulator CzrR BAC0125 Protein 7e-66 60
czrR YP_008112025.1 two-component response regulator CzrR BAC0083 Protein 9e-62 59
czrR YP_008112025.1 two-component response regulator CzrR BAC0197 Protein 2e-64 59
czrR YP_008112025.1 two-component response regulator CzrR BAC0638 Protein 1e-55 59
czrR YP_008112025.1 two-component response regulator CzrR BAC0308 Protein 3e-57 55
czrR YP_008112025.1 two-component response regulator CzrR BAC0111 Protein 9e-62 55
czrR YP_008112025.1 two-component response regulator CzrR BAC0347 Protein 6e-58 51
czrR YP_008112025.1 two-component response regulator CzrR NC_007793.3914065.p0 Protein 1e-37 44
czrR YP_008112025.1 two-component response regulator CzrR NC_002758.1121390.p0 Protein 1e-37 44
czrR YP_008112025.1 two-component response regulator CzrR NC_010079.5776364.p0 Protein 1e-37 44
czrR YP_008112025.1 two-component response regulator CzrR NC_002952.2859858.p0 Protein 1e-37 44
czrR YP_008112025.1 two-component response regulator CzrR NC_007622.3794948.p0 Protein 1e-37 44
czrR YP_008112025.1 two-component response regulator CzrR NC_003923.1003417.p0 Protein 1e-37 44
czrR YP_008112025.1 two-component response regulator CzrR NC_013450.8614146.p0 Protein 1e-37 44
czrR YP_008112025.1 two-component response regulator CzrR NC_002951.3238224.p0 Protein 1e-37 44
czrR YP_008112025.1 two-component response regulator CzrR AE015929.1.gene1106. Protein 5e-33 42
czrR YP_008112025.1 two-component response regulator CzrR AE000516.2.gene3505. Protein 7e-29 42
czrR YP_008112025.1 two-component response regulator CzrR CP001918.1.gene5135. Protein 5e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR YP_008112025.1 two-component response regulator CzrR VFG0596 Protein 4e-56 52
czrR YP_008112025.1 two-component response regulator CzrR VFG1389 Protein 4e-36 44
czrR YP_008112025.1 two-component response regulator CzrR VFG1386 Protein 3e-38 43
czrR YP_008112025.1 two-component response regulator CzrR VFG1390 Protein 5e-38 42
czrR YP_008112025.1 two-component response regulator CzrR VFG0473 Protein 7e-31 41