Name : H650_03430 (H650_03430) Accession : YP_008106536.1 Strain : Enterobacter sp. R4-368 Genome accession: NC_021500 Putative virulence/resistance : Resistance Product : transcriptional regulator Function : - COG functional category : - COG ID : - EC number : - Position : 599540 - 599920 bp Length : 381 bp Strand : + Note : transcriptional activator of genes involved in the multiple antibiotic resistance (Mar) phenotype; also activates sodA, zwf and micF; Derived by automated computational analysis using gene prediction method: GeneMarkS+. DNA sequence : ATGTCCAGACGCAATACTGACGCTATCACTATTCATAGCATTTTGGACTGGATCGAGGACAACCTGGAATCGCCGCTGTC GCTGGAAAAAGTGTCAGAGCGTTCAGGTTACTCCAAGTGGCACCTGCAACGGATGTTTAAAAAAGAGACTGGTCATTCGC TGGGCCAGTACATTCGCAGCCGCAAGCTGACGGAAATTGCGCAAAAGCTCAAGGGAAGTAATGAGCCGATCCTGTATCTG GCAGAGCGTTACGGGTTTGAATCGCAACAAACCTTAACGCGCACGTTTAAGAACTATTTCGACGTGCCGCCGCATAAATT CCGCGTGACGGATATCCCGGCAGAGTCCCGGTATCTATTCCCGCTGAATCACGCTTGTTAA Protein sequence : MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKGSNEPILYL AERYGFESQQTLTRTFKNYFDVPPHKFRVTDIPAESRYLFPLNHAC |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
tetD | AAL08447.1 | putative transcriptional regulator TetD | Not tested | SRL | Protein | 1e-20 | 46 |
tetD | AEA34665.1 | tetracycline resistance protein D | Not tested | Not named | Protein | 1e-20 | 46 |
soxS | YP_219131.1 | DNA-binding transcriptional regulator SoxS | Not tested | SPI-4 | Protein | 2e-19 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP001918.1.gene2033. | Protein | 4e-53 | 93 |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP000647.1.gene1624. | Protein | 6e-52 | 92 |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP001138.1.gene1637. | Protein | 3e-52 | 92 |
H650_03430 | YP_008106536.1 | transcriptional regulator | NC_002695.1.917339.p | Protein | 1e-51 | 92 |
H650_03430 | YP_008106536.1 | transcriptional regulator | BAC0560 | Protein | 1e-51 | 92 |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP000034.1.gene1596. | Protein | 2e-51 | 92 |
H650_03430 | YP_008106536.1 | transcriptional regulator | NC_010558.1.6276025. | Protein | 7e-21 | 46 |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP001138.1.gene612.p | Protein | 3e-22 | 44 |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP000034.1.gene4505. | Protein | 3e-19 | 42 |
H650_03430 | YP_008106536.1 | transcriptional regulator | BAC0371 | Protein | 2e-19 | 42 |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP001138.1.gene4488. | Protein | 6e-20 | 42 |
H650_03430 | YP_008106536.1 | transcriptional regulator | NC_002695.1.914293.p | Protein | 2e-19 | 42 |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP001918.1.gene327.p | Protein | 3e-20 | 42 |
H650_03430 | YP_008106536.1 | transcriptional regulator | CP000647.1.gene4499. | Protein | 8e-20 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
H650_03430 | YP_008106536.1 | transcriptional regulator | VFG1038 | Protein | 6e-21 | 46 |
H650_03430 | YP_008106536.1 | transcriptional regulator | VFG0585 | Protein | 5e-20 | 42 |