Name : H650_18175 (H650_18175) Accession : YP_008109389.1 Strain : Enterobacter sp. R4-368 Genome accession: NC_021500 Putative virulence/resistance : Virulence Product : Rha family transcriptional regulator Function : - COG functional category : - COG ID : - EC number : - Position : 3632938 - 3633144 bp Length : 207 bp Strand : - Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+. DNA sequence : ATGACCAGTAAACCTTCCCTGCTTGAAGATCAGTTTGTCGATATGGCTTTTATCACCCGGCTCACCGGGCTAACTGATAA GTGGTTTTACAAGCTCATCAAAGATGGAGTATTTCCAAAACCCATCAAACTGGGGCGCAGTTCCCGCTGGCTACAGAGTG AAGTCGAAGCCTGGCTTCAGGCCCGTATTGAAGAATCCCGCACTTAG Protein sequence : MTSKPSLLEDQFVDMAFITRLTGLTDKWFYKLIKDGVFPKPIKLGRSSRWLQSEVEAWLQARIEESRT |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 3e-22 | 81 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 3e-21 | 78 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 3e-21 | 78 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 1e-21 | 77 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 1e-21 | 77 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-21 | 77 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-21 | 77 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 2e-21 | 75 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 6e-18 | 70 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 9e-18 | 70 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 4e-14 | 68 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 4e-14 | 68 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
H650_18175 | YP_008109389.1 | Rha family transcriptional regulator | VFG0651 | Protein | 6e-22 | 77 |
H650_18175 | YP_008109389.1 | Rha family transcriptional regulator | VFG1057 | Protein | 7e-22 | 75 |
H650_18175 | YP_008109389.1 | Rha family transcriptional regulator | VFG1480 | Protein | 3e-18 | 70 |