Gene Information

Name : H650_18175 (H650_18175)
Accession : YP_008109389.1
Strain : Enterobacter sp. R4-368
Genome accession: NC_021500
Putative virulence/resistance : Virulence
Product : Rha family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3632938 - 3633144 bp
Length : 207 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGACCAGTAAACCTTCCCTGCTTGAAGATCAGTTTGTCGATATGGCTTTTATCACCCGGCTCACCGGGCTAACTGATAA
GTGGTTTTACAAGCTCATCAAAGATGGAGTATTTCCAAAACCCATCAAACTGGGGCGCAGTTCCCGCTGGCTACAGAGTG
AAGTCGAAGCCTGGCTTCAGGCCCGTATTGAAGAATCCCGCACTTAG

Protein sequence :
MTSKPSLLEDQFVDMAFITRLTGLTDKWFYKLIKDGVFPKPIKLGRSSRWLQSEVEAWLQARIEESRT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 3e-22 81
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 3e-21 78
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 3e-21 78
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-21 77
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-21 77
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-21 77
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-21 77
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-21 75
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 6e-18 70
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-18 70
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 4e-14 68
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 4e-14 68

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H650_18175 YP_008109389.1 Rha family transcriptional regulator VFG0651 Protein 6e-22 77
H650_18175 YP_008109389.1 Rha family transcriptional regulator VFG1057 Protein 7e-22 75
H650_18175 YP_008109389.1 Rha family transcriptional regulator VFG1480 Protein 3e-18 70