Gene Information

Name : H650_02320 (H650_02320)
Accession : YP_008106315.1
Strain : Enterobacter sp. R4-368
Genome accession: NC_021500
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 347105 - 347533 bp
Length : 429 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence : 
ATGAGCAACATTACGATTTATCACAACCCTGACTGCGGCACCTCGCGCAACACGCTGGCGCTGATCCGCAACAGCGGTGT
GGAGCCGACAATTATTCACTACCTTGAGACACCGCCTTCGCGCGATGAACTCACAACACTGATTGGCGCTATGGGCATTT
CAGTGCGTGAGTTGTTGCGCAAAAATGTTGCGCCGTACGAACAACTGGGGCTGGCAGAAGATCGCTTCACCGATGCTCAG
CTGATCGATTTTATGCTTGAGCATCCGATTTTGATTAACCGCCCGATTGTTGTTACCTCGCGCGGTACGCGCCTTTGCCG
CCCGTCGGAAGTGGTGCTGGAGATCCTGCCTGAAGCGCAGAAAGGCGCGTTTACGAAAGAGGATGGGGAGCAGGTTGTTG
ATTGCAACGGTAAGCGGATCGCGCCGTAA

Protein sequence : 
MSNITIYHNPDCGTSRNTLALIRNSGVEPTIIHYLETPPSRDELTTLIGAMGISVRELLRKNVAPYEQLGLAEDRFTDAQ
LIDFMLEHPILINRPIVVTSRGTRLCRPSEVVLEILPEAQKGAFTKEDGEQVVDCNGKRIAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 1e-51 80
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 2e-44 65
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 3e-44 65
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 2e-44 65

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H650_02320 YP_008106315.1 arsenate reductase BAC0582 Protein 6e-54 83
H650_02320 YP_008106315.1 arsenate reductase BAC0583 Protein 5e-54 82
H650_02320 YP_008106315.1 arsenate reductase BAC0584 Protein 1e-54 82
H650_02320 YP_008106315.1 arsenate reductase BAC0585 Protein 2e-51 78