Gene Information

Name : H650_01790 (H650_01790)
Accession : YP_008106210.1
Strain : Enterobacter sp. R4-368
Genome accession: NC_021500
Putative virulence/resistance : Resistance
Product : multidrug transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 236507 - 236845 bp
Length : 339 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGAATAAAGAAGCCTTTATCTTTCTCAGTATTGCCATTGTGATGGAAGTGATTGCCACCACGGCGCTGAAATCTTCCGA
CAGCTTTACCCGTTTGTTACCCGCTATTATCAGTATCGCCGGGTATTGCATCGCATTCTGGTGCCTGACAATTACGATGC
GCACTTTGCCTACCGGGGTGATTTATGCCATCTGGTCAGGTGCAGGTATTGTGCTGATAGGTCTTGCTGGCTGGCTTGTA
CACGGGCAAAAACTGGATATGCCGGCAATCATGGGAATGGGGTTAATTATCGCCGGGGTGGTGATTATTAATCTTTTTTC
CAAAAGCGTTGGGCATTAA

Protein sequence :
MNKEAFIFLSIAIVMEVIATTALKSSDSFTRLLPAIISIAGYCIAFWCLTITMRTLPTGVIYAIWSGAGIVLIGLAGWLV
HGQKLDMPAIMGMGLIIAGVVIINLFSKSVGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-19 56
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-19 56
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-19 56
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-19 56
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-19 56
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-19 56
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-19 56
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-19 56
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-19 56
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-19 56
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-19 56
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-19 56
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-19 56
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-19 56
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-19 56
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-19 56
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-19 56
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-19 56
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-19 56
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-19 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H650_01790 YP_008106210.1 multidrug transporter CP001138.1.gene1489. Protein 3e-36 76
H650_01790 YP_008106210.1 multidrug transporter BAC0377 Protein 4e-25 57
H650_01790 YP_008106210.1 multidrug transporter BAC0323 Protein 5e-20 56
H650_01790 YP_008106210.1 multidrug transporter BAC0150 Protein 2e-23 55
H650_01790 YP_008106210.1 multidrug transporter CP004022.1.gene1549. Protein 3e-26 54
H650_01790 YP_008106210.1 multidrug transporter BAC0322 Protein 8e-24 54
H650_01790 YP_008106210.1 multidrug transporter NC_010410.6003348.p0 Protein 7e-23 54
H650_01790 YP_008106210.1 multidrug transporter BAC0002 Protein 7e-23 54
H650_01790 YP_008106210.1 multidrug transporter NC_002695.1.913273.p Protein 3e-23 53
H650_01790 YP_008106210.1 multidrug transporter BAC0324 Protein 7e-24 52
H650_01790 YP_008106210.1 multidrug transporter BAC0329 Protein 9e-13 42
H650_01790 YP_008106210.1 multidrug transporter BAC0477 Protein 2e-09 42