
|
Name : H650_08915 (H650_08915) Accession : YP_008107609.1 Strain : Enterobacter sp. R4-368 Genome accession: NC_021500 Putative virulence/resistance : Unknown Product : transcriptional regulator Function : - COG functional category : - COG ID : - EC number : - Position : 1734479 - 1734673 bp Length : 195 bp Strand : + Note : Derived by automated computational analysis using gene prediction method: Protein Homology. DNA sequence : ATGATGCATTGCCCGGTATGCCAACAAGCGGCGCACGCGCGCTCCAGCCGCTACCTCAGTTCTGAAACCAAAGAGCGCTA TCACCAGTGCCAGAATATTCACTGTGGTTGTACGTTTGTCACCCATGAGTCGCTGGCGCGTTACATTGTCCGCCCGCCAG CACTGCAAGTGAGCGCGTCCCCCGCCGGGAAGTAA Protein sequence : MMHCPVCQQAAHARSSRYLSSETKERYHQCQNIHCGCTFVTHESLARYIVRPPALQVSASPAGK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| STY4600 | NP_458683.1 | putative positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 2e-11 | 54 |
| t4294 | NP_807891.1 | positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 2e-11 | 54 |