Gene Information

Name : H650_08915 (H650_08915)
Accession : YP_008107609.1
Strain : Enterobacter sp. R4-368
Genome accession: NC_021500
Putative virulence/resistance : Unknown
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1734479 - 1734673 bp
Length : 195 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGATGCATTGCCCGGTATGCCAACAAGCGGCGCACGCGCGCTCCAGCCGCTACCTCAGTTCTGAAACCAAAGAGCGCTA
TCACCAGTGCCAGAATATTCACTGTGGTTGTACGTTTGTCACCCATGAGTCGCTGGCGCGTTACATTGTCCGCCCGCCAG
CACTGCAAGTGAGCGCGTCCCCCGCCGGGAAGTAA

Protein sequence :
MMHCPVCQQAAHARSSRYLSSETKERYHQCQNIHCGCTFVTHESLARYIVRPPALQVSASPAGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
t4294 NP_807891.1 positive regulator of late gene transcription Not tested SPI-7 Protein 2e-11 54
STY4600 NP_458683.1 putative positive regulator of late gene transcription Not tested SPI-7 Protein 2e-11 54