Gene Information

Name : PCA10_36040 (PCA10_36040)
Accession : YP_008103941.1
Strain : Pseudomonas resinovorans NBRC 106553
Genome accession: NC_021499
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3958466 - 3959134 bp
Length : 669 bp
Strand : -
Note : -

DNA sequence : 
ATGCGGTTGTTGCTGGTAGAGGACCATGTACCCCTGGCCGATGAGCTGAGCAGCAGCCTCGGCCGCCAAGGCTACGCCGT
GGACTGGCTGGCCGATGGCCGAGACGCCCTGCACCAGGGGGCCAGCGAGCCCTACGACCTGATCATCCTGGACCTCGGCC
TGCCGGGTAAGCCGGGCCTCGAAGTGCTGCAGCAGTGGCGTGCCGGCGGTCTCTCGACGCCGGTGCTGATCCTCACCGCG
CGCGGTTCGTGGGCCGAGCGTATCGACGGCCTCAAGGCCGGCGCCGACGACTACCTGACCAAGCCCTTCCATCCCGAGGA
ACTGGCCCTGCGCATCCAGGCCTTGCTGCGTCGCGCCCACGGCCTGGCGAACCAGCCGCAACTGGAGGCGGCTGGTCTGC
AGCTGGATGAAGGGCGCCAGTGCGTCAGCCGCAATGGCGAGGAAGTCCAGCTGACCGCGGCCGAGTTCCGCCTGCTGCGT
TACTTCATGCTGCACCCCGGCCAGCTGCTCTCCAAGAGCCACCTGGCCGAGCACCTCTACGATGGCGAGTCCGAGCGGGA
CTCCAACGTTATCGAGGTCCACGTCAACCACCTGCGCCGCAAGCTCGGTCGCGACGTGATAGAGACCCGGCGCGGCCAGG
GTTACCGTTTCACCGGTGAGGGCCGATGA

Protein sequence : 
MRLLLVEDHVPLADELSSSLGRQGYAVDWLADGRDALHQGASEPYDLIILDLGLPGKPGLEVLQQWRAGGLSTPVLILTA
RGSWAERIDGLKAGADDYLTKPFHPEELALRIQALLRRAHGLANQPQLEAAGLQLDEGRQCVSRNGEEVQLTAAEFRLLR
YFMLHPGQLLSKSHLAEHLYDGESERDSNVIEVHVNHLRRKLGRDVIETRRGQGYRFTGEGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCA10_36040 YP_008103941.1 putative two-component response regulator NC_002516.2.879194.p Protein 4e-38 48
PCA10_36040 YP_008103941.1 putative two-component response regulator BAC0638 Protein 2e-26 44
PCA10_36040 YP_008103941.1 putative two-component response regulator CP000647.1.gene1136. Protein 2e-29 43
PCA10_36040 YP_008103941.1 putative two-component response regulator BAC0530 Protein 1e-29 43
PCA10_36040 YP_008103941.1 putative two-component response regulator CP001918.1.gene2526. Protein 4e-29 42
PCA10_36040 YP_008103941.1 putative two-component response regulator CP001138.1.gene1939. Protein 1e-30 42
PCA10_36040 YP_008103941.1 putative two-component response regulator CP004022.1.gene1005. Protein 2e-33 42
PCA10_36040 YP_008103941.1 putative two-component response regulator BAC0197 Protein 8e-29 42
PCA10_36040 YP_008103941.1 putative two-component response regulator NC_002695.1.913289.p Protein 7e-29 41
PCA10_36040 YP_008103941.1 putative two-component response regulator CP000034.1.gene2022. Protein 1e-29 41
PCA10_36040 YP_008103941.1 putative two-component response regulator BAC0083 Protein 2e-29 41
PCA10_36040 YP_008103941.1 putative two-component response regulator BAC0487 Protein 5e-27 41
PCA10_36040 YP_008103941.1 putative two-component response regulator CP001918.1.gene5135. Protein 6e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCA10_36040 YP_008103941.1 putative two-component response regulator VFG0475 Protein 1e-30 42
PCA10_36040 YP_008103941.1 putative two-component response regulator VFG1386 Protein 6e-28 41