Gene Information

Name : L483_16080 (L483_16080)
Accession : YP_008094996.1
Strain : Pseudomonas putida H8234
Genome accession: NC_021491
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3402693 - 3403367 bp
Length : 675 bp
Strand : -
Note : induced by CusR in the presence of copper; YedW induces the expression of the upstream gene yedV (encoding a sensor kinase) as well as yedW; yedVW is one of four copper regulons found in E. coli; part of the copper homeostasis mechanism; confers resistanc

DNA sequence :
ATGCGCGTTCTAGTTGTGGAAGACGAAATTAAAACTGCCGAATATCTTCAGCAGGGCCTATCCGAAAGCGGGTATGTCGT
AGATATCGTGCACAACGGTGTAGATGCCCTGCACTTGTTCAACACTCATGTCTATTCGTTGGTCCTGCTGGACGTGAACC
TCCCAGGTATCGACGGCTGGGATCTGCTGGAAACCATCCGCAAGAGCAGCCGGGTCCGCATCATCATGCTGACCGCCCGC
GGACGCATCAATGACAAGCTCAAGGGCTTGGACGGCGGCGCGGATGACTACCTTGTTAAGCCATTCGAATTCCCTGAGCT
GCTTGCACGCATCCGTTCGCTGCAACGCCGTGGTGATGAGTTAGTAGAGAAGAGCTCGCTGAAAATTGCCGACCTAGAAC
TCGACTCCGTCCGCCATCGCGTTTTCCGCGGTGGCACACGAATCGATCTCACCACCAAGGAATTTGCGCTTTTGCACCTG
CTCATGAGCCGAACGGGCGAAGCGCTGACTCGCTCTCAGATCATCTCGTTGGTCTGGGATATGAATTTCGACTGCGACAC
CAATGTCATCGATGTAGCCATCCGGCGCTTGCGCTCGAAGATCGATGACCCGTTTGAAACCAAGCTCATTCACACGCTTC
GTGGCGTTGGGTACGTTTTTGAGGAACGCGCATGA

Protein sequence :
MRVLVVEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTHVYSLVLLDVNLPGIDGWDLLETIRKSSRVRIIMLTAR
GRINDKLKGLDGGADDYLVKPFEFPELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHL
LMSRTGEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDDPFETKLIHTLRGVGYVFEERA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-48 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-48 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L483_16080 YP_008094996.1 transcriptional regulator BAC0125 Protein 2e-57 60
L483_16080 YP_008094996.1 transcriptional regulator BAC0197 Protein 4e-55 58
L483_16080 YP_008094996.1 transcriptional regulator BAC0083 Protein 3e-54 57
L483_16080 YP_008094996.1 transcriptional regulator BAC0638 Protein 7e-50 57
L483_16080 YP_008094996.1 transcriptional regulator BAC0308 Protein 4e-51 56
L483_16080 YP_008094996.1 transcriptional regulator BAC0111 Protein 3e-54 55
L483_16080 YP_008094996.1 transcriptional regulator BAC0347 Protein 7e-50 52
L483_16080 YP_008094996.1 transcriptional regulator NC_002758.1121390.p0 Protein 6e-31 42
L483_16080 YP_008094996.1 transcriptional regulator NC_010079.5776364.p0 Protein 6e-31 42
L483_16080 YP_008094996.1 transcriptional regulator NC_002952.2859858.p0 Protein 6e-31 42
L483_16080 YP_008094996.1 transcriptional regulator NC_007622.3794948.p0 Protein 6e-31 42
L483_16080 YP_008094996.1 transcriptional regulator NC_003923.1003417.p0 Protein 6e-31 42
L483_16080 YP_008094996.1 transcriptional regulator NC_013450.8614146.p0 Protein 6e-31 42
L483_16080 YP_008094996.1 transcriptional regulator NC_002951.3238224.p0 Protein 6e-31 42
L483_16080 YP_008094996.1 transcriptional regulator NC_007793.3914065.p0 Protein 6e-31 42
L483_16080 YP_008094996.1 transcriptional regulator AE015929.1.gene1106. Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L483_16080 YP_008094996.1 transcriptional regulator VFG0596 Protein 5e-49 52
L483_16080 YP_008094996.1 transcriptional regulator VFG1390 Protein 3e-34 42