Gene Information

Name : CCALI_01602 (CCALI_01602)
Accession : YP_008089530.1
Strain : Chthonomonas calidirosea T49
Genome accession: NC_021487
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1898945 - 1899631 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGTCTGAAGCCGCTCGCATTCTTGTGGTGGACGATGAGCAGCCAATCGCGGAGGCAATAGCCTACAACCTAAAAAAAGA
GGGGTTCTCTGTGCAGACGGCAGCCGATGCCGAGACCTGTCTTGAACTTGTGCGCACGACACCGCCCTCTCTGGTCATTC
TCGACATTATGCTGCCCTCCATTAGTGGCTTCGACGTGTGTCGCCTGTTGCGTCGCCAGGGAGACATCCCCATTATTATG
CTAACGGCTCGCACGGGGGAACACGACCGCGTGAAAGGGCTTGAACTCGGTGCCGACGATTATGTTACCAAGCCGTTCAA
CATGCGTGAGCTTATTGCGCGCGTGCGAAGCGTGCTGCGGCGTACCGCGCCCTCGCACGACAAAGATGAGACCATTAAGA
TAGGGAACCTCTTTATAGATGTTGGTCGGCATGAAGCTCGATTGGGTGAGAGGCCCTTAAACCTCGCTCCAAAAGAGTTC
GACCTCCTGCGTTTTCTTGCTACCCATCCCGGCCGTGTATTTACACGCCAAATGCTTCTCGATCGCGTCTGGGGCACGGA
GGCTTTTGTGGATGAACGCACGGTGGATGTGCATATCCGCTGGCTACGGGAGAAGATAGAAGAAGACCCCTCCAATCCGC
GCCGACTTATTACGGTGAGGGGTGTGGGCTACAAGTTCGCCGAATAG

Protein sequence :
MSEAARILVVDDEQPIAEAIAYNLKKEGFSVQTAADAETCLELVRTTPPSLVILDIMLPSISGFDVCRLLRRQGDIPIIM
LTARTGEHDRVKGLELGADDYVTKPFNMRELIARVRSVLRRTAPSHDKDETIKIGNLFIDVGRHEARLGERPLNLAPKEF
DLLRFLATHPGRVFTRQMLLDRVWGTEAFVDERTVDVHIRWLREKIEEDPSNPRRLITVRGVGYKFAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-39 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 2e-49 49
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 2e-42 48
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 5e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 4e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 4e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 4e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 4e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 4e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 4e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 4e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 4e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 5e-47 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 2e-48 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 7e-48 46
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 2e-42 43
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 2e-42 43
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 2e-32 43
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene5135. Protein 7e-27 42
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AM180355.1.gene1830. Protein 3e-38 42
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 3e-44 42
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0347 Protein 9e-35 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 1e-36 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001138.1.gene4273. Protein 4e-30 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 8e-32 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP004022.1.gene3215. Protein 2e-34 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 3e-43 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene3671. Protein 4e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 2e-32 43
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 9e-40 42
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 4e-34 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1563 Protein 9e-40 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1702 Protein 1e-39 41
CCALI_01602 YP_008089530.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 1e-38 41