Gene Information

Name : CCALI_01167 (CCALI_01167)
Accession : YP_008089110.1
Strain : Chthonomonas calidirosea T49
Genome accession: NC_021487
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1364249 - 1364914 bp
Length : 666 bp
Strand : +
Note : -

DNA sequence :
ATGAATATACTGATCGTAGAGGACGATAAGAGCGTCGCCCGCTTTCTACAGCAAGCCCTTACTGAGGCCGGCTATACCAC
ACAGGTTGTCGAAGATGGGGAGACTGCACTCCACTTGGCCGTGAGCATCGCCTTCGATCTTATCCTTCTCGACGTCATGC
TGCCCCGCAAGGATGGCTTTGCCCTTTGTAAGGAGTTGCGGGCGGCCTCGGTTACCACCCCCATCCTCATCATCACCGCT
CGTGACACGCTAGAAGACAAAATTGAAGGGCTTGATAGCGGTGCCGATGACTACATCGTTAAACCTTGCCAGATAGGTGA
ACTGTTGGCAAGAGTACGCGCACTTCTACGGCGCGGTACCTCTAGCCCACCGGTGCTTCGCGTTGCCGATCTCACTTTAG
ACCCGGCCACCCGAAAAGTCTGCCGCCAGGGAAAAACCATCCATCTCTCTATGACGGAGTTCGCCCTCCTGGAATATCTC
ATGCGGAATGCAGGGCGCGTGGTAACACGCTTAATGATTCTGGAACATGTCTGGCAGTACGACTTTGAAGGCAACGATAA
TGTGCTCGATGTCTATATTAGCTACCTGCGCAGCAAGATTGACCGTGGTTTTGCCCGCCCACTCATTCACACGGTACGTG
GCGTAGGCTACCGTTTGGAGGGCTAA

Protein sequence :
MNILIVEDDKSVARFLQQALTEAGYTTQVVEDGETALHLAVSIAFDLILLDVMLPRKDGFALCKELRAASVTTPILIITA
RDTLEDKIEGLDSGADDYIVKPCQIGELLARVRALLRRGTSSPPVLRVADLTLDPATRKVCRQGKTIHLSMTEFALLEYL
MRNAGRVVTRLMILEHVWQYDFEGNDNVLDVYISYLRSKIDRGFARPLIHTVRGVGYRLEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-37 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 44
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 1e-42 51
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 4e-36 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 4e-36 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 4e-36 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 4e-36 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 4e-36 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 4e-36 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 4e-36 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 4e-36 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 8e-40 48
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 1e-42 47
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 3e-33 46
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 2e-40 46
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0347 Protein 6e-39 46
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 1e-34 46
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 7e-38 45
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 3e-39 44
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 3e-31 43
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF310956.2.orf0.gene Protein 4e-26 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-32 41
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 1e-43 47
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 3e-37 44
CCALI_01167 YP_008089110.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 8e-38 43