Gene Information

Name : MSA_21720 (MSA_21720)
Accession : YP_008087906.1
Strain : Streptococcus agalactiae ILRI005
Genome accession: NC_021486
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2033317 - 2033988 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATCCTTGTTGTTGAAGATGAGTTTGACTTGAACCGTAGTATTGTAAAACTTTTAAAAAAGCAACACTACAGTGT
TGACAGTGCTTCAAATGGTGAAGAAGCCTTACAATTTGTTTCAGTGGCAGAATATGATGTGATTATCTTAGATGTAATGA
TGCCAAAAATGGACGGCTTCACCTTTTTAAAACTGCTTCGCAACAAAGGAAGTCAAGTATCTATTCTTATGTTGACTGCT
CGAGATGCCGTTGAAGATCGTATCGCAGGTCTAGATTTTGGTGCGGATGATTACCTTGTAAAACCATTTGAATTTGGAGA
ACTCATGGCCCGAATTCGAGCTATGTTACGACGTACAAATAGACAAGTATCTTCTGATGATATTCAAATTCAAGATATAA
CAATCAATTTATCTACAAAGCAAGTTTGGAGAAACGACAATTTGATTGATTTAACAGCTAAGGAATACGAAGTCCTTGAG
TATTTGGCACGTCACAGAGACCAAGTCCTCTCTCGTCATCAAATTCGTGAACACGTTTGGGATTATGATTATGATGGAGA
GTCCAATATTATTGATGTCCTTATCAAAAACCTTCGTCGAAAACTAGATAACAACCGAGACGGATCACTAATAAAAACTA
AACGAGGTTTAGGATATGTTATTCCAAAGTAA

Protein sequence :
MKILVVEDEFDLNRSIVKLLKKQHYSVDSASNGEEALQFVSVAEYDVIILDVMMPKMDGFTFLKLLRNKGSQVSILMLTA
RDAVEDRIAGLDFGADDYLVKPFEFGELMARIRAMLRRTNRQVSSDDIQIQDITINLSTKQVWRNDNLIDLTAKEYEVLE
YLARHRDQVLSRHQIREHVWDYDYDGESNIIDVLIKNLRRKLDNNRDGSLIKTKRGLGYVIPK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MSA_21720 YP_008087906.1 DNA-binding response regulator BAC0125 Protein 3e-40 46
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 2e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 1e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 1e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 2e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 1e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 1e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 1e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 1e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 1e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 1e-37 44
MSA_21720 YP_008087906.1 DNA-binding response regulator BAC0638 Protein 9e-38 44
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 2e-34 43
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 2e-34 43
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 2e-34 43
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 2e-34 43
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 2e-34 43
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 2e-34 43
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 2e-34 43
MSA_21720 YP_008087906.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 2e-34 43
MSA_21720 YP_008087906.1 DNA-binding response regulator BAC0083 Protein 8e-41 43
MSA_21720 YP_008087906.1 DNA-binding response regulator BAC0308 Protein 4e-39 43
MSA_21720 YP_008087906.1 DNA-binding response regulator AE015929.1.gene1106. Protein 3e-31 42
MSA_21720 YP_008087906.1 DNA-binding response regulator BAC0111 Protein 4e-43 42
MSA_21720 YP_008087906.1 DNA-binding response regulator HE999704.1.gene2815. Protein 2e-34 42
MSA_21720 YP_008087906.1 DNA-binding response regulator BAC0197 Protein 6e-37 42
MSA_21720 YP_008087906.1 DNA-binding response regulator BAC0347 Protein 2e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MSA_21720 YP_008087906.1 DNA-binding response regulator VFG1390 Protein 2e-39 42
MSA_21720 YP_008087906.1 DNA-binding response regulator VFG0596 Protein 4e-34 41