Gene Information

Name : phoP (BaLi_c31400)
Accession : YP_008079221.1
Strain : Bacillus licheniformis 9945A
Genome accession: NC_021362
Putative virulence/resistance : Resistance
Product : two-component response regulator PhoP
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3131267 - 3131989 bp
Length : 723 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAAAAAGATATTAGTTGTAGATGATGAGGAATCGATTGTTACCCTTCTAAAATATAACCTTGAACGGTCGGGCTA
TCATGTGGTGACGGCCATGGACGGAGAGGCCGGCTTATTAAAGGCGATTGAAGAGAAGCCGGATCTGATCGTGCTCGATC
TGATGCTTCCTAAAATGGACGGCATTGAAGTATGCAAGGAACTCAGACAGAAGAAGCTGATGTATCCGATTTTGATGCTG
ACCGCTAAGGATGATGAATTTGATAAGGTGCTCGGTCTCGAGCTGGGTGCCGATGACTATATGACGAAGCCGTTCAGCCC
GAGAGAGGTGACGGCAAGGGTCAAAGCGATTTTAAGAAGAACACAGACGCTGTCCGTTCATCCGGAGGAGACGGAAGAAC
CGGATGCAGGCGAGCTGATCATAGGCGAATTGAAAATACTGCCAGAACATTATGAGGTTTACTTTCAAAACGAACGCCTC
GAGCTAACGCCTAAGGAATTCGAACTCCTTTTATATTTGGGAAGGCATAAAGGGAGGGTGCTGACGAGAGACCTTCTCCT
CAACGCTGTCTGGAACTACGACTTCGCGGGCGATACGCGCATCGTCGATGTCCATATCAGCCATCTTCGCGATAAGATCG
AAAAAAATACGAAAAAACCGGAATACATTAAAACAATCAGAGGTCTTGGCTACAAAATGGAGGAGCCGAAGCTGAATGAT
TAA

Protein sequence :
MSKKILVVDDEESIVTLLKYNLERSGYHVVTAMDGEAGLLKAIEEKPDLIVLDLMLPKMDGIEVCKELRQKKLMYPILML
TAKDDEFDKVLGLELGADDYMTKPFSPREVTARVKAILRRTQTLSVHPEETEEPDAGELIIGELKILPEHYEVYFQNERL
ELTPKEFELLLYLGRHKGRVLTRDLLLNAVWNYDFAGDTRIVDVHISHLRDKIEKNTKKPEYIKTIRGLGYKMEEPKLND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-37 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 9e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_008079221.1 two-component response regulator PhoP NC_002952.2859905.p0 Protein 2e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_009782.5559369.p0 Protein 3e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_002951.3237708.p0 Protein 3e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_002758.1121668.p0 Protein 3e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_003923.1003749.p0 Protein 2e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_009641.5332272.p0 Protein 3e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_013450.8614421.p0 Protein 3e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_007793.3914279.p0 Protein 3e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_007622.3794472.p0 Protein 2e-75 69
phoP YP_008079221.1 two-component response regulator PhoP NC_002745.1124361.p0 Protein 3e-75 69
phoP YP_008079221.1 two-component response regulator PhoP HE999704.1.gene2815. Protein 9e-77 69
phoP YP_008079221.1 two-component response regulator PhoP AE016830.1.gene1681. Protein 6e-65 57
phoP YP_008079221.1 two-component response regulator PhoP NC_012469.1.7686381. Protein 4e-60 55
phoP YP_008079221.1 two-component response regulator PhoP NC_012469.1.7685629. Protein 3e-57 54
phoP YP_008079221.1 two-component response regulator PhoP CP004022.1.gene3215. Protein 8e-40 45
phoP YP_008079221.1 two-component response regulator PhoP AF162694.1.orf4.gene Protein 5e-38 43
phoP YP_008079221.1 two-component response regulator PhoP CP001485.1.gene721.p Protein 7e-36 43
phoP YP_008079221.1 two-component response regulator PhoP NC_014475.1.orf0.gen Protein 7e-41 42
phoP YP_008079221.1 two-component response regulator PhoP NC_005054.2598277.p0 Protein 7e-41 42
phoP YP_008079221.1 two-component response regulator PhoP AE000516.2.gene3505. Protein 4e-41 42
phoP YP_008079221.1 two-component response regulator PhoP AF155139.2.orf0.gene Protein 2e-39 42
phoP YP_008079221.1 two-component response regulator PhoP FJ349556.1.orf0.gene Protein 1e-41 42
phoP YP_008079221.1 two-component response regulator PhoP CP000647.1.gene4257. Protein 2e-35 42
phoP YP_008079221.1 two-component response regulator PhoP BAC0533 Protein 2e-35 42
phoP YP_008079221.1 two-component response regulator PhoP AF310956.2.orf0.gene Protein 2e-37 41
phoP YP_008079221.1 two-component response regulator PhoP AE016830.1.gene2255. Protein 4e-36 41
phoP YP_008079221.1 two-component response regulator PhoP U35369.1.gene1.p01 Protein 4e-36 41
phoP YP_008079221.1 two-component response regulator PhoP HE999704.1.gene1528. Protein 3e-32 41
phoP YP_008079221.1 two-component response regulator PhoP AF130997.1.orf0.gene Protein 1e-36 41
phoP YP_008079221.1 two-component response regulator PhoP EU250284.1.orf4.gene Protein 2e-41 41
phoP YP_008079221.1 two-component response regulator PhoP BAC0197 Protein 2e-29 41
phoP YP_008079221.1 two-component response regulator PhoP AM180355.1.gene1830. Protein 3e-38 41
phoP YP_008079221.1 two-component response regulator PhoP DQ212986.1.gene4.p01 Protein 3e-40 41
phoP YP_008079221.1 two-component response regulator PhoP NC_002695.1.915041.p Protein 1e-34 41
phoP YP_008079221.1 two-component response regulator PhoP CP000034.1.gene3834. Protein 1e-34 41
phoP YP_008079221.1 two-component response regulator PhoP CP001138.1.gene4273. Protein 8e-35 41
phoP YP_008079221.1 two-component response regulator PhoP CP001918.1.gene5135. Protein 2e-30 41
phoP YP_008079221.1 two-component response regulator PhoP CP004022.1.gene1676. Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_008079221.1 two-component response regulator PhoP VFG1386 Protein 6e-39 42
phoP YP_008079221.1 two-component response regulator PhoP VFG1389 Protein 2e-32 42
phoP YP_008079221.1 two-component response regulator PhoP VFG1390 Protein 1e-35 41