Gene Information

Name : K710_1425 (K710_1425)
Accession : YP_008057123.1
Strain : Streptococcus iniae SF1
Genome accession: NC_021314
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein WalR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1382628 - 1383338 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGAAGAAAATTCTTATAGTTGATGATGAAAAACCGATTTCAGATATCATCAAATTTAATTTAACAAAAGAAGGATATGA
AACGGTGACAGCTTTTGATGGACGTGAAGCAGTTACCTTGTTTGAAGAAGAAAAACCAGACTTGGTTATTTTAGATTTGA
TGTTACCTGAAATGGATGGTTTAGAAGTTGCTAAAGAAATTCGTAAAACAAGCCACATTCCAATTGTTATGTTATCAGCA
AAAGATAGTGAGTTTGATAAGGTCATCGGTCTTGAAATTGGTGCAGATGACTATGTGACAAAACCATTTTCTAATCGTGA
GCTATTAGCTCGTGTTAAGGCGCATTTGCGCCGTACAGAAACCATCGAAACAGCAGTTGCTGAAGAAAATGCCTCAGCTG
GTAATCAAGAGTTAACGATTGGCAACCTTCAAATCTTGCCAGATGCCTTTTTAGCTAAAAAGCATGGTCAAGAGGTTGAG
TTAACCCACCGTGAATTTGAATTATTGCATCACTTAGCCAACCATATTGGGCAAGTAATGACTCGTGAACATTTGCTTGA
AACTGTTTGGGGCTATGATTATTTTGGTGATGTTAGAACAGTTGACGTAACGGTACGTCGTTTGCGAGAAAAAATCGAAG
ATACTCCTAGCCGTCCTGAATATATTTTGACAAGACGAGGAGTTGGATACTACATGAAATCACATGACTAA

Protein sequence :
MKKILIVDDEKPISDIIKFNLTKEGYETVTAFDGREAVTLFEEEKPDLVILDLMLPEMDGLEVAKEIRKTSHIPIVMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTETIETAVAEENASAGNQELTIGNLQILPDAFLAKKHGQEVE
LTHREFELLHHLANHIGQVMTREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMKSHD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_012469.1.7685629. Protein 1e-81 78
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR HE999704.1.gene2815. Protein 1e-50 54
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_002952.2859905.p0 Protein 5e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_003923.1003749.p0 Protein 5e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_009641.5332272.p0 Protein 7e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_013450.8614421.p0 Protein 7e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_007793.3914279.p0 Protein 7e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_007622.3794472.p0 Protein 5e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_002745.1124361.p0 Protein 7e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_009782.5559369.p0 Protein 7e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_002951.3237708.p0 Protein 7e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_002758.1121668.p0 Protein 7e-50 51
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_012469.1.7686381. Protein 1e-42 48
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR AE016830.1.gene1681. Protein 7e-44 47
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR CP000647.1.gene4257. Protein 4e-30 44
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR BAC0533 Protein 4e-30 44
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR FJ349556.1.orf0.gene Protein 2e-38 43
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR AF155139.2.orf0.gene Protein 2e-37 43
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR DQ212986.1.gene4.p01 Protein 9e-37 43
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR CP001138.1.gene4273. Protein 1e-29 43
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR CP004022.1.gene3215. Protein 1e-32 43
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR NC_002695.1.915041.p Protein 2e-29 43
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR CP000034.1.gene3834. Protein 2e-29 43
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR AF162694.1.orf4.gene Protein 3e-34 42
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR AM180355.1.gene1830. Protein 1e-36 42
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR AE000516.2.gene3505. Protein 3e-34 42
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR AE015929.1.gene1106. Protein 6e-30 42
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR HE999704.1.gene1528. Protein 8e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR VFG1563 Protein 7e-36 42
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR VFG1702 Protein 7e-36 42
K710_1425 YP_008057123.1 transcriptional regulatory protein WalR VFG1389 Protein 1e-30 41