Gene Information

Name : BRPE64_BCDS07750 (BRPE64_BCDS07750)
Accession : YP_008048036.1
Strain :
Genome accession: NC_021294
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 772871 - 773602 bp
Length : 732 bp
Strand : -
Note : -

DNA sequence :
ATGGATCATCCGAAACGCATTCTGATCGTCGAAGACGACATGCATATCGCCGATGTGCTGAGTCTCAACCTGCGCGACGA
GCGCTATGAAGTCGTGCATTCCGCCGATGGCGCCGAAGGATTGCGCTTGCTCGAACAAGGCGGCTGGGACGCGCTGATTC
TCGATCTGATGTTGCCGGGCGTCGACGGCCTTGAAATATGCCGTCGCGCGCGGGCCATGACGCGCTATACGCCGATCATC
ATCACGAGCGCGCGGTCGAGTGAAGTGCATCGCATACTCGGTCTGGAACTCGGCGCAGACGATTATCTTGCCAAGCCTTT
CTCGGTGCTGGAACTCGTCGCGCGCGTGAAGGCGTTGCTGCGCCGCGTCGATGCCGTCGCGAAAGATTCACGGCACGATG
CCGGGCGCATCGAAGTGTCGGGCATCGCGATGGATCCGCTTGCGCGTGAAGCGTGGGTCGATGGCGCGCGTATCGAACTC
ACGCCGCGCGAATTCGATTTGCTCTATCACTTCGCGCGTCATCCGAACAAAGTGTTTTCGCGTATGGATCTGCTCAACGC
GGTGTGGGGTTATCGGCACGAAGGCTATGAGCACACCGTGAACACGCATATCAACCGGCTGCGCGCGAAGGTAGAGAAGG
ACGCATCGGATCCCAAACGCATTCTCACGGTATGGGGTCACGGCTATAAGCTCGCGACGCAAGCGCCGGAGGGCGAGGGT
GCCGCACCGTGA

Protein sequence :
MDHPKRILIVEDDMHIADVLSLNLRDERYEVVHSADGAEGLRLLEQGGWDALILDLMLPGVDGLEICRRARAMTRYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDAVAKDSRHDAGRIEVSGIAMDPLAREAWVDGARIEL
TPREFDLLYHFARHPNKVFSRMDLLNAVWGYRHEGYEHTVNTHINRLRAKVEKDASDPKRILTVWGHGYKLATQAPEGEG
AAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-69 59
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-69 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_003923.1003417.p0 Protein 7e-36 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_013450.8614146.p0 Protein 7e-36 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_002951.3238224.p0 Protein 7e-36 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_007793.3914065.p0 Protein 7e-36 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_002758.1121390.p0 Protein 7e-36 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_010079.5776364.p0 Protein 7e-36 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_002952.2859858.p0 Protein 7e-36 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_007622.3794948.p0 Protein 7e-36 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_012469.1.7685629. Protein 4e-43 45
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family AE015929.1.gene1106. Protein 1e-30 43
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family AE000516.2.gene3505. Protein 3e-38 43
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family FJ349556.1.orf0.gene Protein 5e-38 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family AF155139.2.orf0.gene Protein 2e-39 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_002952.2859905.p0 Protein 3e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_002951.3237708.p0 Protein 4e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_002758.1121668.p0 Protein 4e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_009641.5332272.p0 Protein 4e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_013450.8614421.p0 Protein 4e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_007793.3914279.p0 Protein 4e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_003923.1003749.p0 Protein 4e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_007622.3794472.p0 Protein 3e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_002745.1124361.p0 Protein 4e-40 42
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family NC_009782.5559369.p0 Protein 4e-40 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family VFG1563 Protein 2e-69 59
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family VFG1702 Protein 2e-69 59
BRPE64_BCDS07750 YP_008048036.1 Two component transcriptional regulator winged helix family VFG1389 Protein 7e-32 44