Gene Information

Name : SPISAL_01980 (SPISAL_01980)
Accession : YP_008045960.1
Strain : Spiribacter salinus M19-40
Genome accession: NC_021291
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 403522 - 403845 bp
Length : 324 bp
Strand : +
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGCCAGCCTGGTTGTTGTTGATCGGTGCCATTGTCATGGAAGTCGTGGGCACCACGGCGCTGAAGCTCTCAGACGGGTT
TACGCGTCTTGTCCCCAGCCTGGTCGTGGTGGCCGGCTATGCGCTGGCGTTTATTGGTCTGGGTCTTGTTTTAAAACGGA
TGGAGGTCAGTGTGGCCTATGCGATCTGGGCCGGGCTGGGTACGGCACTTGTCGCGCTTGTGGGTGTCTTTCTATTTGGG
GAGACAATGAATTGGGTCAAAGCAGGCAGTCTGGGTTTGATTGTTGTTGGCTTGATCGGGCTCAACCTGGCGGGCGGTTC
TTGA

Protein sequence :
MPAWLLLIGAIVMEVVGTTALKLSDGFTRLVPSLVVVAGYALAFIGLGLVLKRMEVSVAYAIWAGLGTALVALVGVFLFG
ETMNWVKAGSLGLIVVGLIGLNLAGGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-15 50
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-15 50
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-15 50
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-15 50
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-15 50
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-15 50
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-15 50
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-15 50
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 4e-15 50
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-15 50
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-15 50
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-15 50
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-15 50
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-15 50
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-15 50
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 4e-15 50
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-15 50
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-15 50
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-15 50
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 4e-15 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0324 Protein 2e-15 54
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0140 Protein 1e-10 53
SPISAL_01980 YP_008045960.1 small multidrug resistance protein CP004022.1.gene1549. Protein 2e-14 52
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0377 Protein 7e-16 51
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0322 Protein 2e-15 50
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0323 Protein 1e-15 50
SPISAL_01980 YP_008045960.1 small multidrug resistance protein CP001138.1.gene1489. Protein 2e-12 46
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0139 Protein 8e-11 45
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0216 Protein 4e-07 44
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0249 Protein 2e-09 43
SPISAL_01980 YP_008045960.1 small multidrug resistance protein AE000516.2.gene3301. Protein 2e-09 43
SPISAL_01980 YP_008045960.1 small multidrug resistance protein NC_002695.1.913273.p Protein 1e-08 41
SPISAL_01980 YP_008045960.1 small multidrug resistance protein BAC0150 Protein 1e-08 41