Gene Information

Name : AHML_09360 (AHML_09360)
Accession : YP_008043001.1
Strain : Aeromonas hydrophila ML09-119
Genome accession: NC_021290
Putative virulence/resistance : Unknown
Product : IS3 family transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2068984 - 2069295 bp
Length : 312 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGACAACATTACGTCGCTCATTCACTGCCGAATTCAAGCTGAAAGCCGCATCCCTAGTGCTCGACCAAGGCTATTCAGT
CCCCGAAGCCAACCGTTCACTGGATGTCGGCGAAACCGTGCTTCGCCGATGGGTTCAGCAACTTCAATCCGAGCGAACTG
GCATAACCCCTATCAGCAAGGCTCTGACCCCAGAGCAACAGAAAATCCAGGAACTGGAAGCCCGCATCAACCGGCTTGAA
CGCGAAAAGGCCATTCTAAAAAAGGCTACTGCTCTCTTGATGGCGGACGAGCTCAAACGTACGCGCAGATAG

Protein sequence :
MTTLRRSFTAEFKLKAASLVLDQGYSVPEANRSLDVGETVLRRWVQQLQSERTGITPISKALTPEQQKIQELEARINRLE
REKAILKKATALLMADELKRTRR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-32 76
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-22 55
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-22 55
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-22 55
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-22 55
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-22 55
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-22 55
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-22 55
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-22 55
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-23 53
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-23 53
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 8e-21 52
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-21 51
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-21 51
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-21 51
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-21 51
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-21 50
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-21 50
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-21 50
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-17 49
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 4e-17 47
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-17 43
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-12 42
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-17 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AHML_09360 YP_008043001.1 IS3 family transposase VFG1123 Protein 9e-23 55
AHML_09360 YP_008043001.1 IS3 family transposase VFG1553 Protein 3e-21 52
AHML_09360 YP_008043001.1 IS3 family transposase VFG0784 Protein 5e-22 51
AHML_09360 YP_008043001.1 IS3 family transposase VFG1485 Protein 7e-22 50
AHML_09360 YP_008043001.1 IS3 family transposase VFG1566 Protein 1e-12 42