Gene Information

Name : folP (BRPE64_ACDS19310)
Accession : YP_008038081.1
Strain :
Genome accession: NC_021287
Putative virulence/resistance : Resistance
Product : dihydropteroate synthase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2014796 - 2015596 bp
Length : 801 bp
Strand : -
Note : -

DNA sequence :
ATGGGCATTCTCAATGTCACGCCGGACTCGTTTTCTGATGGCGGCCGCTTTCTTTCCCGCGACGCCGCGCTGGCACGCGC
CGAAAAAATGCTCGCCGACGGCGCCGACATGATCGACATCGGCGGCGAATCGACGCGTCCCGGCGCGCCGCCCGTTCCGC
TCGACGAAGAGCTCGAGCGCGTCGTGCCGATCGTCGAAGCGCTGCGGACGGTGCAGGTGCCGATCTCCGTCGATACCTAC
AAGCCCGTCGTCATGCGCGCCGCGCTCGACGCGGGCGCGGACATGATCAACGACATCTGGGGCTTGCGTCAGGAAGGCGC
GCTCGAGGCCGTCAAGGACAGCGATTGTGGGCTGTGCGTGATGCACATGCTCGGCGAGCCGCGCACGATGCAACTCCACG
AACCGTTCTATGACGACGTGGTCGCCGAAGTGCGCACGTTTTTCGCCGAGCGGCTCGCATCGCTCGCGCACGCGGGAATT
GCAAAAGAACGTGTGAGCCTCGATCCGGGCTATGGCTTCGGAAAGACGGTGGAGCATAATTACCAGTTGCTCGCCCATCT
GCGCGCGACGCTTCCCGTCGACGCCAATCTCCCGCTGCTCGCAGGCATGTCGCGCAAATCGATGCTCGGCGCTGTCACCG
GTCGCGGCGCGGGCGAACGCCTCGCGGCGAGCGTGGCCGCGGCGGTCTGCGCGGCAGAGCGGGGCGCAGCGATCATCCGC
GTGCATGACGTCGCGGAAACGGTCGATGCCCTGAAGGTCTGGGAGGCCACAAAGAAGGCCGCTTTCGGCGGGCACTATTG
A

Protein sequence :
MGILNVTPDSFSDGGRFLSRDAALARAEKMLADGADMIDIGGESTRPGAPPVPLDEELERVVPIVEALRTVQVPISVDTY
KPVVMRAALDAGADMINDIWGLRQEGALEAVKDSDCGLCVMHMLGEPRTMQLHEPFYDDVVAEVRTFFAERLASLAHAGI
AKERVSLDPGYGFGKTVEHNYQLLAHLRATLPVDANLPLLAGMSRKSMLGAVTGRGAGERLAASVAAAVCAAERGAAIIR
VHDVAETVDALKVWEATKKAAFGGHY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sul2 AEZ06044.1 Sul2, sulphonamide-insensitive dihydropteroate synthase Not tested Tn6167 Protein 4e-34 41
sul2 AEA34678.1 dihydropteroate synthase Not tested Not named Protein 3e-34 41
sulI2 AFV47959.1 sulphonamide-insensitive dihydropteroate synthase SulI2 Not tested AbaR25 Protein 3e-34 41
BJAB0868_00253 YP_008211579.1 Dihydropteroate synthase-related enzyme Not tested AbaR26 Protein 7e-34 41
ABK1_0255 YP_005512827.1 Dihydropteroate synthase type-2 Not tested AbaR4d Protein 6e-34 41
BJAB07104_00246 YP_008207711.1 Dihydropteroate synthase-related enzyme Not tested AbaR25 Protein 6e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
folP YP_008038081.1 dihydropteroate synthase CP002695.1.gene1085. Protein 2e-60 60
folP YP_008038081.1 dihydropteroate synthase NC_008702.1.4608834. Protein 4e-51 58
folP YP_008038081.1 dihydropteroate synthase NC_002695.1.916103.p Protein 8e-50 57
folP YP_008038081.1 dihydropteroate synthase NC_002516.2.881715.p Protein 1e-51 56
folP YP_008038081.1 dihydropteroate synthase CP004022.1.gene3451. Protein 4e-50 56
folP YP_008038081.1 dihydropteroate synthase CP000647.1.gene3624. Protein 4e-49 56
folP YP_008038081.1 dihydropteroate synthase CP000034.1.gene3358. Protein 1e-48 56
folP YP_008038081.1 dihydropteroate synthase CP001138.1.gene3456. Protein 3e-47 55
folP YP_008038081.1 dihydropteroate synthase CP000675.2.gene3019. Protein 6e-49 51
folP YP_008038081.1 dihydropteroate synthase NC_010400.5986775.p0 Protein 1e-28 45
folP YP_008038081.1 dihydropteroate synthase NC_011586.7045137.p0 Protein 8e-29 45
folP YP_008038081.1 dihydropteroate synthase NC_010410.6003232.p0 Protein 8e-29 45
folP YP_008038081.1 dihydropteroate synthase NC_011595.7059722.p0 Protein 8e-29 45
folP YP_008038081.1 dihydropteroate synthase NC_003923.1002573.p0 Protein 8e-28 43
folP YP_008038081.1 dihydropteroate synthase NC_002758.1120474.p0 Protein 6e-28 43
folP YP_008038081.1 dihydropteroate synthase NC_009782.5559617.p0 Protein 6e-28 43
folP YP_008038081.1 dihydropteroate synthase NC_007793.3915320.p0 Protein 8e-28 43
folP YP_008038081.1 dihydropteroate synthase NC_002745.1123263.p0 Protein 6e-28 43
folP YP_008038081.1 dihydropteroate synthase NC_013450.8613224.p0 Protein 6e-28 43
folP YP_008038081.1 dihydropteroate synthase AM180355.1.gene1650. Protein 9e-36 42
folP YP_008038081.1 dihydropteroate synthase NC_009641.5330254.p0 Protein 7e-27 42
folP YP_008038081.1 dihydropteroate synthase NC_002951.3237126.p0 Protein 3e-27 42
folP YP_008038081.1 dihydropteroate synthase AE016830.1.gene3181. Protein 2e-27 41
folP YP_008038081.1 dihydropteroate synthase DQ464881.1.gene2.p01 Protein 2e-33 41
folP YP_008038081.1 dihydropteroate synthase NC_002952.2860679.p0 Protein 3e-27 41
folP YP_008038081.1 dihydropteroate synthase NC_007622.3794340.p0 Protein 5e-28 41