Gene Information

Name : K734_08270 (K734_08270)
Accession : YP_008035149.1
Strain : Idiomarina loihiensis GSL 199
Genome accession: NC_021286
Putative virulence/resistance : Resistance
Product : transcriptional regulator MerR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1758872 - 1759315 bp
Length : 444 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGTTAAAAAAACGCAACGTAATGACAATTGGCACGCTGGCCAAAACAGCCGGCGTGGGCGTGGAAACGGTGCGCTATTA
TCAGCGCCGAGGGCTAATGAGCGAGCCGGAAAAGCCGTATGGGGGGATCCGACATTACGACGAACAAGCGCTTGCTCGGC
TTCATTTTATTCGCGCGTCTCAATGGCTTGGATTTAGTCTGGATGAAATTGGTGAGCTATTAACTCTGCAAGATGGCGCT
CATTGCGATGAGGCACGGGAGCTTGGGGAGCAAAAGCTCACCAGTGTTCGTCGAAAGATATCGCACTTACAGCAAATTGA
ACGAGCGTTGAATGAGCTGGTGCAAAAATGCAGCGCCGGACACGGAGATGTCTATTGTCCACTGATGGCCTCGCTTAATG
ACGGGGTTGAGGACGCTACCACGGACAAACATAAGGTGCGTTAG

Protein sequence :
MLKKRNVMTIGTLAKTAGVGVETVRYYQRRGLMSEPEKPYGGIRHYDEQALARLHFIRASQWLGFSLDEIGELLTLQDGA
HCDEARELGEQKLTSVRRKISHLQQIERALNELVQKCSAGHGDVYCPLMASLNDGVEDATTDKHKVR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 9e-40 58
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-36 56
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-36 56
merR ACK44535.1 MerR Not tested SGI1 Protein 9e-37 56
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 9e-37 56
merR AFG30124.1 MerR Not tested PAGI-2 Protein 9e-37 56
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-36 56
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-38 55
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-38 55
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-35 50
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 7e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
K734_08270 YP_008035149.1 transcriptional regulator MerR BAC0232 Protein 1e-37 56
K734_08270 YP_008035149.1 transcriptional regulator MerR BAC0687 Protein 1e-37 56
K734_08270 YP_008035149.1 transcriptional regulator MerR BAC0689 Protein 2e-36 56
K734_08270 YP_008035149.1 transcriptional regulator MerR BAC0688 Protein 3e-38 55
K734_08270 YP_008035149.1 transcriptional regulator MerR BAC0683 Protein 5e-38 55
K734_08270 YP_008035149.1 transcriptional regulator MerR BAC0684 Protein 5e-38 54
K734_08270 YP_008035149.1 transcriptional regulator MerR BAC0686 Protein 2e-38 53
K734_08270 YP_008035149.1 transcriptional regulator MerR BAC0682 Protein 8e-23 43