Gene Information

Name : NH44784_009851 (NH44784_009851)
Accession : YP_008028086.1
Strain : Achromobacter xylosoxidans NH44784-1996
Genome accession: NC_021285
Putative virulence/resistance : Resistance
Product : Periplasmic mercury(+2) binding protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1039260 - 1039547 bp
Length : 288 bp
Strand : -
Note : -

DNA sequence :
ATGAAGAAACTCACCACCCTCACCACCCTCATCGCCCTGGCCGCCGCTCTAAGCGCGCCCGCCTGGGCTGCCACCAAGAC
CGTCACCCTGTCGGTGCCCGGCATGACCTGCGCCGCGTGCCCGATCACGGTCAAGACGGCTCTGTCCAAGGTCGCCGGCG
TCGAGAAGGCCGAAGTCAGCTTCGAGAAGCGGGAGGCCGTCGTCACCTTCGACGAGGCCAAGACCAATGCCGACGCCTTG
ACCAAGGCCACCGCAAACGCGGGTTACCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLTTLTTLIALAAALSAPAWAATKTVTLSVPGMTCAACPITVKTALSKVAGVEKAEVSFEKREAVVTFDEAKTNADAL
TKATANAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 7e-26 100
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-22 80
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-21 78
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-21 78
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-21 78
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-21 78
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-21 78
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-21 78
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-21 76
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-21 76

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH44784_009851 YP_008028086.1 Periplasmic mercury(+2) binding protein BAC0678 Protein 3e-21 76
NH44784_009851 YP_008028086.1 Periplasmic mercury(+2) binding protein BAC0679 Protein 5e-21 76
NH44784_009851 YP_008028086.1 Periplasmic mercury(+2) binding protein BAC0231 Protein 2e-20 75
NH44784_009851 YP_008028086.1 Periplasmic mercury(+2) binding protein BAC0675 Protein 4e-19 68
NH44784_009851 YP_008028086.1 Periplasmic mercury(+2) binding protein BAC0674 Protein 2e-17 62