Gene Information

Name : NH44784_007941 (NH44784_007941)
Accession : YP_008027897.1
Strain : Achromobacter xylosoxidans NH44784-1996
Genome accession: NC_021285
Putative virulence/resistance : Resistance
Product : Ethidium bromide-methyl viologen resistance protein EmrE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 848199 - 848528 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence :
ATGAAGTGGCTCTACCTGGGCATCGCCATCGTCGCCGAGATCTTCGCCACCAGCGCGCTGAAAAGCTCCGATGGCTTTTC
ACGGCTGGTGCCGTCGGTGGTGACGGTGTTCGGCTACATGATCTCGTTCTATTTCCTGTCGCTGACGCTGCGCGAGGTGC
CGGTCGGCATCGCCTACGCCATCTGGTCGGGCGTGGGCATCGTGCTCATCTCCCTGATCGGCGCGCTGTTCTTCAGGCAG
CACCTGGACACCCCGGCGCTGGTCGGCATCGGCCTGATCATCGCCGGCGTGGTGGTCATGAACGTCTTCTCGAAGTCCGT
GTCGCACTGA

Protein sequence :
MKWLYLGIAIVAEIFATSALKSSDGFSRLVPSVVTVFGYMISFYFLSLTLREVPVGIAYAIWSGVGIVLISLIGALFFRQ
HLDTPALVGIGLIIAGVVVMNVFSKSVSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-20 60
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-20 60
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-20 60
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-20 60
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-20 60
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 4e-20 60
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-20 60
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 4e-20 60
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-20 60
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-20 60
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-20 60
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-20 60
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-20 60
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-20 60
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-20 60
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-20 60
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 4e-20 60
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-20 60
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-20 60
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-20 60
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 43
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 9e-12 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE CP001138.1.gene1489. Protein 1e-20 63
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE NC_010410.6003348.p0 Protein 3e-22 61
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0002 Protein 3e-22 61
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0324 Protein 1e-20 60
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0322 Protein 7e-21 60
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0323 Protein 1e-20 60
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE CP004022.1.gene1549. Protein 5e-16 58
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE NC_002695.1.913273.p Protein 2e-15 57
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0150 Protein 1e-15 56
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0377 Protein 6e-17 54
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0329 Protein 7e-18 51
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0325 Protein 9e-15 45
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0139 Protein 3e-15 45
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0326 Protein 3e-17 45
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE AE000516.2.gene3301. Protein 7e-10 44
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0249 Protein 7e-10 44
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0321 Protein 2e-16 43
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE BAC0327 Protein 6e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE VFG1587 Protein 9e-13 43
NH44784_007941 YP_008027897.1 Ethidium bromide-methyl viologen resistance protein EmrE VFG1586 Protein 4e-12 41