Gene Information

Name : NH44784_014541 (NH44784_014541)
Accession : YP_008028549.1
Strain : Achromobacter xylosoxidans NH44784-1996
Genome accession: NC_021285
Putative virulence/resistance : Virulence
Product : Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1537679 - 1538347 bp
Length : 669 bp
Strand : -
Note : -

DNA sequence :
ATGAACGGCGCGGATCCGATCAGCCTGGCGGTTGTCCTGGCGCTGTTGGCGCTGGTGCCGCTGGCCGCCGTCATGACCAC
CTCGTTCCTGAAGATCGCGGTGGTGCTGACGCTGGTGCGCAATGCCCTGGGCGTGCAGCAGGTGCCGCCCAACATGGCGC
TGTACGGGTTGGCGCTGATCCTGTCCGCGTATGTCATGGGGCCCGTGGTGATGCAGATCGGTGATGAGCTGCGCGCGCCG
CCGGCCGTGGCGGCGCCTGGCACGCCCGAGCCGGACCGGCTCGAAGGCATTCTCGAGGCGGTGGCGCGCGGCGCCGAGCC
GATGCGCGCCTTCATGCTCAAGAACAGCCGCGCGGAGCAGCGCGATTTCTTCCTGCGCACCGCGCGCGGACTGTGGGGCG
AGCAGCAGGCCCGCAACCTGAAGGAAGACGACCTGCTGGTGCTGATTCCGTCGTTCCTGCTGTCGGAACTGACCGCCGCT
TTCCAGATTGGCTTCCTGCTCTACCTGCCGTTCGTCATCATCGACCTGATCGTCTCCAACATCCTGCTGGCGATGGGCAT
GATGATGGTGTCGCCAGTCACGATTTCCATGCCCCTGAAGCTGTTCCTGTTCGTCATGGTCGACGGCTGGACGCGGCTGA
TCCAGGGTCTGGTGCTGTCCTATACCTGA

Protein sequence :
MNGADPISLAVVLALLALVPLAAVMTTSFLKIAVVLTLVRNALGVQQVPPNMALYGLALILSAYVMGPVVMQIGDELRAP
PAVAAPGTPEPDRLEGILEAVARGAEPMRAFMLKNSRAEQRDFFLRTARGLWGEQQARNLKEDDLLVLIPSFLLSELTAA
FQIGFLLYLPFVIIDLIVSNILLAMGMMMVSPVTISMPLKLFLFVMVDGWTRLIQGLVLSYT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lscR AAO18040.1 LscR Virulence TTSS locus Protein 8e-51 57
hrcR AAP34349.1 HrcR Virulence Hrp PAI Protein 5e-47 52
hrcR NP_636600.1 type III secretion system protein Virulence Hrp PAI Protein 3e-46 52
hrcR NP_640757.1 type III secretion system protein Virulence Hrp PAI Protein 9e-47 52
hrcR YP_362153.1 type III secretion system protein Virulence Hrp PAI Protein 9e-47 52
hrcR AAD21321.1 HrcR Virulence Hrp PAI Protein 6e-47 52
XC_3016 YP_244084.1 type III secretion system protein Virulence Hrp PAI Protein 3e-46 52
hrcR BAB07862.1 HrcR Virulence Hrp PAI Protein 3e-46 51
hrcR YP_198720.1 type III secretion system protein Virulence Hrp PAI Protein 3e-46 51
hrcR AAT96262.1 HrcR Virulence S-PAI Protein 2e-43 50
hrcR AAT96303.1 HrcR Virulence S-PAI Protein 2e-43 50
hrcR AAT96343.1 HrcR Virulence S-PAI Protein 2e-43 50
YPO0270 YP_002345352.1 type III secretion system protein Virulence Not named Protein 3e-41 50
hrcR ABA47279.1 HrcR Virulence S-PAI Protein 9e-43 49
hrcR ABQ88359.1 HrcR Virulence Hrp PAI Protein 2e-36 49
hrpW AAB05075.1 HrpW Virulence Hrp PAI Protein 2e-36 49
hrcR AAT96146.1 HrcR Virulence T-PAI Protein 1e-36 49
hrcR AAT96200.1 HrcR Virulence T-PAI Protein 9e-37 49
escR AAK26700.1 EscR Virulence LEE Protein 2e-41 49
escR AAL57527.1 EscR Virulence LEE Protein 2e-41 49
escR CAC81847.1 EscR protein Virulence LEE II Protein 2e-41 49
escR CAI43889.1 EscR protein Virulence LEE Protein 2e-41 49
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 3e-41 49
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 3e-41 49
hrcR NP_791222.3 type III secretion protein HrcR Virulence Hrp PAI Protein 4e-37 48
hrcR AAG33884.1 HrcR Virulence Hrp PAI Protein 4e-37 48
ssaR CAA68199.1 secretion system apparatus, SsaR Virulence SPI-2 Protein 3e-41 48
ssaR YP_216427.1 type III secretion system protein Virulence SPI-2 Protein 5e-41 48
ssaR NP_460384.1 type III secretion system protein Virulence SPI-2 Protein 5e-41 48
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 2e-41 48
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 4e-41 48
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 4e-41 48
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 4e-41 48
escR AAC38369.1 EscR Virulence LEE Protein 2e-40 48
escR AAC31528.1 L0049 Virulence LEE Protein 2e-41 48
yscR NP_456109.1 putative type III secretion protein Virulence SPI-2 Protein 1e-40 47
yscR NP_805090.1 type III secretion system protein Virulence SPI-2 Protein 1e-40 47
escR AFO66317.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 4e-39 47
escR AFO66400.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 4e-39 47
unnamed AAL06354.1 EscR Virulence LEE Protein 2e-41 47
hrcR AAB06005.2 HrcR Virulence Hrp PAI Protein 3e-42 46
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 2e-35 42
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 2e-36 42
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 4e-26 41
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 4e-26 41
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 9e-26 41
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 9e-26 41
ysaR AAS66846.1 YsaR Not tested SSR-1 Protein 2e-35 41
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG0044 Protein 4e-73 77
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG0188 Protein 4e-49 54
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG0394 Protein 2e-48 54
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG0519 Protein 2e-41 48
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG0715 Protein 1e-40 48
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG0827 Protein 1e-41 48
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG1773 Protein 2e-36 44
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG2016 Protein 5e-33 43
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG2494 Protein 2e-33 43
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG0551 Protein 1e-26 41
NH44784_014541 YP_008028549.1 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components VFG2455 Protein 3e-31 41