|
Name : NH44784_014531 (NH44784_014531) Accession : YP_008028548.1 Strain : Achromobacter xylosoxidans NH44784-1996 Genome accession: NC_021285 Putative virulence/resistance : Virulence Product : Type III secretion inner membrane protein (YscS,homologous to flagellar export components Function : - COG functional category : - COG ID : - EC number : - Position : 1537405 - 1537671 bp Length : 267 bp Strand : - Note : - DNA sequence : ATGGGAACCGTCGACCTCGTTTCGTACATGACGCAGGCGCTCTACCTGGTGCTGTGGCTGTCCCTGCCGCCGATCGCCGT GGCGGCGATCGTGGGCACACTGTTCTCGCTGTTCCAGGCGCTGACGCAGATCCAGGAACAGACGCTGTCGTTCGCCGTCA AGCTGATCGCGGTGTTCGCCACCATCATGCTGACGGCGCGCTGGCTCAGCGCCGAGCTGTACAACTTCACGATCTCTGTG TTCGACCTCTTCTACAAGATCCACTAG Protein sequence : MGTVDLVSYMTQALYLVLWLSLPPIAVAAIVGTLFSLFQALTQIQEQTLSFAVKLIAVFATIMLTARWLSAELYNFTISV FDLFYKIH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 7e-15 | 59 |
| epaQ | AAZ31292.1 | EpaQ | Virulence | ETT2 | Protein | 2e-11 | 50 |
| ECs3724 | NP_311751.1 | EpaQ | Not tested | LIM | Protein | 2e-11 | 50 |
| hrcS | ABQ88360.1 | HrcS | Virulence | Hrp PAI | Protein | 2e-09 | 49 |
| hrpO | AAB05076.1 | HrpO | Virulence | Hrp PAI | Protein | 2e-09 | 49 |
| hrcS | AAT96147.1 | HrcS | Virulence | T-PAI | Protein | 8e-13 | 49 |
| hrcS | AAT96201.1 | HrcS | Virulence | T-PAI | Protein | 8e-13 | 49 |
| ysaS | AAS66847.1 | YsaS | Not tested | SSR-1 | Protein | 7e-10 | 48 |
| hrcS | NP_791221.1 | type III secretion protein HrcS | Virulence | Hrp PAI | Protein | 5e-13 | 48 |
| hrcS | AAG33885.1 | HrcS | Virulence | Hrp PAI | Protein | 3e-13 | 48 |
| ssaS | NP_456108.1 | putative type III secretion protein | Virulence | SPI-2 | Protein | 3e-07 | 47 |
| ssaS | CAA68200.1 | secretion system apparatus, SsaS | Virulence | SPI-2 | Protein | 2e-07 | 47 |
| ssaS | NP_805091.1 | type III secretion protein | Virulence | SPI-2 | Protein | 3e-07 | 47 |
| ssaS | YP_216428.1 | secretion system apparatus protein SsaS | Virulence | SPI-2 | Protein | 4e-07 | 47 |
| ssaS | NP_460385.1 | type III secretion system apparatus protein | Virulence | SPI-2 | Protein | 4e-07 | 47 |
| spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | Virulence | SPI-1 | Protein | 5e-07 | 47 |
| spaQ | NP_457283.1 | secretory protein (associated with virulence) | Virulence | SPI-1 | Protein | 5e-07 | 47 |
| spaQ | NP_806492.1 | virulence-associated secretory protein | Virulence | SPI-1 | Protein | 5e-07 | 47 |
| spaQ | NP_461810.1 | needle complex export protein | Virulence | SPI-1 | Protein | 5e-07 | 47 |
| hrcS | ABA47280.1 | HrcS | Virulence | S-PAI | Protein | 1e-09 | 46 |
| escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 1e-10 | 46 |
| escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 1e-10 | 46 |
| escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 1e-10 | 46 |
| escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-10 | 46 |
| escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-10 | 46 |
| hrcS | AAB06006.1 | HrcS | Virulence | Hrp PAI | Protein | 6e-12 | 45 |
| escS | YP_003236102.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 3e-10 | 45 |
| escS | NP_290282.1 | hypothetical protein | Virulence | LEE | Protein | 3e-10 | 45 |
| ECs4582 | NP_312609.1 | EscS | Virulence | LEE | Protein | 3e-10 | 45 |
| escS | AAC38370.1 | EscS | Virulence | LEE | Protein | 2e-10 | 45 |
| escS | AAC31527.1 | L0048 | Virulence | LEE | Protein | 2e-10 | 45 |
| escS | ACU09472.1 | hypothetical protein | Not tested | LEE | Protein | 2e-10 | 45 |
| escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 3e-10 | 44 |
| escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 3e-10 | 44 |
| hrcS | AAT96344.1 | HrcS | Virulence | S-PAI | Protein | 1e-09 | 44 |
| hrcS | AAT96263.1 | HrcS | Virulence | S-PAI | Protein | 1e-09 | 44 |
| hrcS | AAT96304.1 | HrcS | Virulence | S-PAI | Protein | 1e-09 | 44 |
| escS | CAI43888.1 | EscS protein | Virulence | LEE | Protein | 3e-10 | 44 |
| unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 8e-11 | 43 |
| spaQ | AAS66866.1 | SpaQ | Not tested | SSR-2 | Protein | 1e-08 | 43 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG0043 | Protein | 6e-30 | 85 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG0395 | Protein | 4e-15 | 60 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG0187 | Protein | 5e-11 | 56 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG0520 | Protein | 1e-07 | 47 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG0550 | Protein | 1e-07 | 47 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG2132 | Protein | 8e-14 | 47 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG0826 | Protein | 8e-11 | 45 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG0716 | Protein | 8e-11 | 45 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG1013 | Protein | 2e-08 | 43 |
| NH44784_014531 | YP_008028548.1 | Type III secretion inner membrane protein (YscS,homologous to flagellar export components | VFG1772 | Protein | 8e-11 | 42 |
