Gene Information

Name : NH44784_014531 (NH44784_014531)
Accession : YP_008028548.1
Strain : Achromobacter xylosoxidans NH44784-1996
Genome accession: NC_021285
Putative virulence/resistance : Virulence
Product : Type III secretion inner membrane protein (YscS,homologous to flagellar export components
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1537405 - 1537671 bp
Length : 267 bp
Strand : -
Note : -

DNA sequence :
ATGGGAACCGTCGACCTCGTTTCGTACATGACGCAGGCGCTCTACCTGGTGCTGTGGCTGTCCCTGCCGCCGATCGCCGT
GGCGGCGATCGTGGGCACACTGTTCTCGCTGTTCCAGGCGCTGACGCAGATCCAGGAACAGACGCTGTCGTTCGCCGTCA
AGCTGATCGCGGTGTTCGCCACCATCATGCTGACGGCGCGCTGGCTCAGCGCCGAGCTGTACAACTTCACGATCTCTGTG
TTCGACCTCTTCTACAAGATCCACTAG

Protein sequence :
MGTVDLVSYMTQALYLVLWLSLPPIAVAAIVGTLFSLFQALTQIQEQTLSFAVKLIAVFATIMLTARWLSAELYNFTISV
FDLFYKIH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lscS AAO18039.1 LscS Virulence TTSS locus Protein 7e-15 59
ECs3724 NP_311751.1 EpaQ Not tested LIM Protein 2e-11 50
epaQ AAZ31292.1 EpaQ Virulence ETT2 Protein 2e-11 50
hrcS AAT96147.1 HrcS Virulence T-PAI Protein 8e-13 49
hrcS AAT96201.1 HrcS Virulence T-PAI Protein 8e-13 49
hrcS ABQ88360.1 HrcS Virulence Hrp PAI Protein 2e-09 49
hrpO AAB05076.1 HrpO Virulence Hrp PAI Protein 2e-09 49
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 7e-10 48
hrcS AAG33885.1 HrcS Virulence Hrp PAI Protein 3e-13 48
hrcS NP_791221.1 type III secretion protein HrcS Virulence Hrp PAI Protein 5e-13 48
ssaS YP_216428.1 secretion system apparatus protein SsaS Virulence SPI-2 Protein 4e-07 47
ssaS NP_460385.1 type III secretion system apparatus protein Virulence SPI-2 Protein 4e-07 47
ssaS NP_456108.1 putative type III secretion protein Virulence SPI-2 Protein 3e-07 47
ssaS CAA68200.1 secretion system apparatus, SsaS Virulence SPI-2 Protein 2e-07 47
ssaS NP_805091.1 type III secretion protein Virulence SPI-2 Protein 3e-07 47
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 5e-07 47
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 5e-07 47
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 5e-07 47
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 5e-07 47
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 1e-09 46
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 2e-10 46
escS AAK26701.1 EscS Virulence LEE Protein 1e-10 46
escS AAL57528.1 EscS Virulence LEE Protein 1e-10 46
escS CAC81848.1 EscS protein Virulence LEE II Protein 1e-10 46
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 2e-10 46
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 6e-12 45
escS AAC31527.1 L0048 Virulence LEE Protein 2e-10 45
escS ACU09472.1 hypothetical protein Not tested LEE Protein 2e-10 45
escS YP_003236102.1 T3SS structure protein EscS Virulence LEE Protein 3e-10 45
escS NP_290282.1 hypothetical protein Virulence LEE Protein 3e-10 45
ECs4582 NP_312609.1 EscS Virulence LEE Protein 3e-10 45
escS AAC38370.1 EscS Virulence LEE Protein 2e-10 45
escS AFO66341.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 3e-10 44
escS AFO66401.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 3e-10 44
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 1e-09 44
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 1e-09 44
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 1e-09 44
escS CAI43888.1 EscS protein Virulence LEE Protein 3e-10 44
unnamed AAL06355.1 EscS Virulence LEE Protein 8e-11 43
spaQ AAS66866.1 SpaQ Not tested SSR-2 Protein 1e-08 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG0043 Protein 6e-30 85
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG0395 Protein 4e-15 60
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG0187 Protein 5e-11 56
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG0520 Protein 1e-07 47
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG0550 Protein 1e-07 47
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG2132 Protein 8e-14 47
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG0826 Protein 8e-11 45
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG0716 Protein 8e-11 45
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG1013 Protein 2e-08 43
NH44784_014531 YP_008028548.1 Type III secretion inner membrane protein (YscS,homologous to flagellar export components VFG1772 Protein 8e-11 42