Gene Information

Name : MASS_2312 (MASS_2312)
Accession : YP_008022778.1
Strain : Mycobacterium abscessus 50594
Genome accession: NC_021282
Putative virulence/resistance : Unknown
Product : IS1137, transposase orfA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2376751 - 2377077 bp
Length : 327 bp
Strand : +
Note : -

DNA sequence :
GTGGGATCGAAGTCATCGAGGCGGTATCCAGACGAGCTGAAGGTGCGGGCGGTGCAGATGGTGGCCGATCTGCGCAGCGA
GACAGTTTCGGAGTGGGAGGCGATGGGCCGGGTTGCTGACCTGCTGGGCGTCGGTACTGCCGAAACGGTGCGCAAATGGG
TCCGCCAGGCTGAGATCGACGCCGGCTCTCGGGCGGGGCAGACCAGCGAGGAATCCGAGGTCCTGCGCAAGCTGCGCCGG
GAGAATGCCGAACTCAAGCGGGCCAACGCGATCTTGAAGGCGGCCTCGGTTTTCTTCGCCGCCGAGCTCGACCGGCCCTC
TCAGTAG

Protein sequence :
MGSKSSRRYPDELKVRAVQMVADLRSETVSEWEAMGRVADLLGVGTAETVRKWVRQAEIDAGSRAGQTSEESEVLRKLRR
ENAELKRANAILKAASVFFAAELDRPSQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 9e-13 47
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 9e-13 47
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 9e-13 47
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 9e-13 47
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 1e-12 46
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-11 46
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 1e-12 46
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-11 46
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 1e-12 46
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 4e-11 46
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 1e-12 46
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 1e-12 46
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-10 45
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 2e-10 45
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 3e-10 45
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-10 45
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 3e-10 45
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 9e-10 45
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-10 45
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 6e-09 45
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 8e-09 45
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 3e-10 44
unnamed AAF09023.1 unknown Not tested SHI-O Protein 3e-10 44
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-08 43
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-08 43
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 4e-08 43
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 5e-08 43
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 4e-08 43
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 2e-08 43
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 3e-09 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MASS_2312 YP_008022778.1 IS1137, transposase orfA VFG1603 Protein 4e-10 45
MASS_2312 YP_008022778.1 IS1137, transposase orfA VFG0643 Protein 9e-11 45
MASS_2312 YP_008022778.1 IS1137, transposase orfA VFG0606 Protein 9e-10 43
MASS_2312 YP_008022778.1 IS1137, transposase orfA VFG1717 Protein 1e-08 43