Gene Information

Name : AORI_6131 (AORI_6131)
Accession : YP_008015117.1
Strain : Amycolatopsis orientalis HCCB10007
Genome accession: NC_021252
Putative virulence/resistance : Virulence
Product : two-component system, OmpR family, response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6905574 - 6906269 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
GTGAACACCGAGAACCCCGTGCGCCTGCTGGTGGTGGACGACGAGCCGCATATCGCCGATCTGGTGGCCACTGTCGCCCG
CTACGAGGGCTGGCAGGCCGTGACCGCCGGATCGGGCGAGGCCGCGCTGGCCAAGGCGGCCGAATTCGTGCCCGACATCG
TCGTGCTCGACCTGATGCTGCCCGGGATCGACGGGTTCACCGTGCTGGACAAGCTCCGCGAGGCCGGGACGGCGGTACCC
GTGGTCTTCCTCACCGCGAAGGACGCGACCGCGGACCGCGTCGCCGGGCTCACCCGGGGCGGTGACGACTACCTCGTGAA
GCCGTTCTCCGTCGAGGAACTGATGGCGCGGCTGCGCGCGGTCCTGCGGCGGAGCACCAACCAGGCGAAGGCCGCGGTGC
TGCGGGTCGGCGACCTGACCCTCAACGAGGACACCCGCGAGGTCGCCCGCGACGGCAAACCGGCCGACCTGACCCCGACC
GAATACGAACTGCTGCGCTACCTCATGCGGCATTCGCCCTCGGTGATGACGAAGGCGCAGATCCTCGACCACGTCTGGGA
GTACGACTTCGGCGGCCGGTCCAATGTGGTCGAACTCGTCATCTCGCATCTGCGCCGCAAGATCGACACGGGCGACGAGC
CGCTGATCCACACCGTGCGCGGCGTGGGCTACGTCGTGCGCCAGGCGGCGAGATGA

Protein sequence :
MNTENPVRLLVVDDEPHIADLVATVARYEGWQAVTAGSGEAALAKAAEFVPDIVVLDLMLPGIDGFTVLDKLREAGTAVP
VVFLTAKDATADRVAGLTRGGDDYLVKPFSVEELMARLRAVLRRSTNQAKAAVLRVGDLTLNEDTREVARDGKPADLTPT
EYELLRYLMRHSPSVMTKAQILDHVWEYDFGGRSNVVELVISHLRRKIDTGDEPLIHTVRGVGYVVRQAAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator BAC0197 Protein 1e-38 49
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator BAC0125 Protein 1e-34 47
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator BAC0308 Protein 7e-35 47
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator AE015929.1.gene1106. Protein 6e-30 46
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_002951.3238224.p0 Protein 1e-34 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_007793.3914065.p0 Protein 1e-34 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_002758.1121390.p0 Protein 1e-34 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_010079.5776364.p0 Protein 1e-34 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_002952.2859858.p0 Protein 1e-34 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_007622.3794948.p0 Protein 1e-34 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_003923.1003417.p0 Protein 1e-34 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_013450.8614146.p0 Protein 1e-34 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator BAC0638 Protein 7e-33 45
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator HE999704.1.gene2815. Protein 3e-35 43
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator HE999704.1.gene1528. Protein 1e-27 43
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator BAC0083 Protein 2e-39 42
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator AE000516.2.gene3505. Protein 3e-30 42
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_002952.2859905.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_002745.1124361.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_009782.5559369.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_002951.3237708.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_003923.1003749.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_007622.3794472.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_002758.1121668.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_009641.5332272.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_013450.8614421.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator NC_007793.3914279.p0 Protein 1e-31 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator BAC0347 Protein 2e-32 41
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator BAC0111 Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator VFG1386 Protein 2e-53 51
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator VFG1389 Protein 2e-37 47
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator VFG1390 Protein 1e-41 44
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator VFG0473 Protein 5e-27 43
AORI_6131 YP_008015117.1 two-component system, OmpR family, response regulator VFG0596 Protein 4e-31 42