Gene Information

Name : AORI_2168 (AORI_2168)
Accession : YP_008011159.1
Strain : Amycolatopsis orientalis HCCB10007
Genome accession: NC_021252
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2326737 - 2327399 bp
Length : 663 bp
Strand : +
Note : -

DNA sequence :
GTGACCAGTGTGCTCGTGGTGGAGGACTCCGCCAGGATCGGCGCCTTCGTCGAGAAAGGCCTGCGGGCGCAGGGTTTCGC
GACTCGCTGGGTTCAAACCGGCTCCGAAGGGCTGACCGAGGCGCTGACCGGCGCGCACGACCTCGTCGTCCTCGACCTCG
GTCTGCCGGACCTCGACGGCTCGGATCTGCTGCGGGCCCTGCGCGCGGCGGGCCGGACGGTACCGGTGATCATCCTGACC
GCGCGGGACAGTGTCGTCGACCGGGTCGCCGGGCTGTCCGACGGCGCCGACGACTACCTGGCCAAACCCTTCGCGTTCGA
GGAACTGCTGGCACGGATCCGGTTGCGGCTGCGGGGGAATCCCGAAGCCGAGCCGGCCGTGCTGCGTGCCGGGGACCTCT
CGCTCGACCTGCGCACACGGCGGGTTTCGGTGGCGGGGGAGGAGAAGGACCTCACCGCCCGCGAGTTCGCGCTGCTGGAG
ACGTTGCTGCGCAACCGCGGCCAGGTGCTGTCCCGCGAGCAACTGCTCGGCGGGGTCTGGGGTTTCGATTTCGACCCCGG
CTCGAACGTGGTGGACGTCTACATCCGTTATCTGCGCGGGAAGATCGGCGCGGAGCGGATCGAAACCGTGCGGGGGATGG
GCTACCGGCTCGGTGAGTCCTGA

Protein sequence :
MTSVLVVEDSARIGAFVEKGLRAQGFATRWVQTGSEGLTEALTGAHDLVVLDLGLPDLDGSDLLRALRAAGRTVPVIILT
ARDSVVDRVAGLSDGADDYLAKPFAFEELLARIRLRLRGNPEAEPAVLRAGDLSLDLRTRRVSVAGEEKDLTAREFALLE
TLLRNRGQVLSREQLLGGVWGFDFDPGSNVVDVYIRYLRGKIGAERIETVRGMGYRLGES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-22 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-22 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-33 48
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-29 48
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-31 48
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator BAC0638 Protein 8e-26 47
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-26 45
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-25 44
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 8e-29 44
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-29 44
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator BAC0308 Protein 9e-28 43
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-12 41
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-29 47
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-28 45
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-23 45
AORI_2168 YP_008011159.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-23 42