Gene Information

Name : KPR_4530 (KPR_4530)
Accession : YP_007993504.1
Strain : Klebsiella pneumoniae SB3432
Genome accession: NC_021232
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4659934 - 4660272 bp
Length : 339 bp
Strand : +
Note : highly similar to transposase InsN for insertion sequence element IS911 from Shigella dysenteriae (sp|P39213)

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGCTCCAATGAAAAGAAGAAATTTTAGTCCTGAATTCAAACGCGAATCAGC
TCAGTTGGTTGTCGATCAAAACTACACCGTCTCTGATGCCGCTAAGGCTATGGATGTTGGTCTTTCCACGATGACGAAAT
GGGTCAGGCAACTGCGTGAAGAACGTCAGGGCAAAACGCCAAAAGCCTCCCCGATAACGCCGGAACAAATCGAAATACGC
GAGCTGAAGAAAAAGCTCCAACGTATTGAAATGGAAAACGATATACTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTC
CCTGAACAATTCTCGTTAA

Protein sequence :
MICSPQNNTGAPMKRRNFSPEFKRESAQLVVDQNYTVSDAAKAMDVGLSTMTKWVRQLREERQGKTPKASPITPEQIEIR
ELKKKLQRIEMENDILKKATALLMSDSLNNSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-40 90
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-40 90
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-34 90
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-39 89
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-35 75
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 75
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 75
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-35 75
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 75
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-35 75
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 75
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 75
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 6e-29 66
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 7e-24 61
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-27 60
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-27 60
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-26 59
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-26 59
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-26 59
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-22 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-20 46
tnpA CAB61575.1 transposase A Not tested HPI Protein 3e-20 45
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-13 44
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KPR_4530 YP_007993504.1 hypothetical protein VFG1485 Protein 2e-40 90
KPR_4530 YP_007993504.1 hypothetical protein VFG1123 Protein 3e-35 75
KPR_4530 YP_007993504.1 hypothetical protein VFG1553 Protein 2e-29 66
KPR_4530 YP_007993504.1 hypothetical protein VFG0784 Protein 9e-27 59
KPR_4530 YP_007993504.1 hypothetical protein VFG1566 Protein 4e-14 44
KPR_4530 YP_007993504.1 hypothetical protein VFG1521 Protein 7e-13 41