Gene Information

Name : KPR_1323 (KPR_1323)
Accession : YP_007990304.1
Strain : Klebsiella pneumoniae SB3432
Genome accession: NC_021232
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1382759 - 1383124 bp
Length : 366 bp
Strand : +
Note : highly similar to putative transcriptional regulator, AraC family from Enterobacter cloacae (tr|D6DNF1)

DNA sequence : 
ATGATGAACACTGGCGCCATCATTCAGGATCTGATCGACTGGATCGACAACCATCTTGATAGCCGTCTGGATATTGACAC
CGTTGCCCGACGAGCCGGCTATTCGAAGTGGCACCTGCAGCGGATCTTCAAAGAACATACCGGGCAGCCCCTCGGAGAAT
ATATTCGGGCGAAAAAGCTGCAAAAGTCGATCGAACGCTTGGCCCACAGCAACGAGCCGATCCTGAACGTGGCGATTGCC
CTCGGCTTTGACTCCCAGCAGTCCTTCAACCGCAGCTTCAAGCGCCAGTACGGCCAGGCGCCCGGCGTCTGGCGCCGGAG
TATCAGCCGCTCTGTTGCGCAGACATCTCGTCAGCGATCCGCATGA

Protein sequence : 
MMNTGAIIQDLIDWIDNHLDSRLDIDTVARRAGYSKWHLQRIFKEHTGQPLGEYIRAKKLQKSIERLAHSNEPILNVAIA
LGFDSQQSFNRSFKRQYGQAPGVWRRSISRSVAQTSRQRSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-24 46
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 9e-20 44
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 9e-20 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KPR_1323 YP_007990304.1 hypothetical protein CP000647.1.gene4499. Protein 8e-26 48
KPR_1323 YP_007990304.1 hypothetical protein BAC0371 Protein 5e-25 47
KPR_1323 YP_007990304.1 hypothetical protein NC_002695.1.914293.p Protein 5e-25 47
KPR_1323 YP_007990304.1 hypothetical protein CP000647.1.gene1624. Protein 5e-24 47
KPR_1323 YP_007990304.1 hypothetical protein CP001918.1.gene2033. Protein 6e-24 47
KPR_1323 YP_007990304.1 hypothetical protein CP000034.1.gene4505. Protein 1e-24 46
KPR_1323 YP_007990304.1 hypothetical protein CP001138.1.gene4488. Protein 7e-25 46
KPR_1323 YP_007990304.1 hypothetical protein CP001138.1.gene1637. Protein 1e-23 46
KPR_1323 YP_007990304.1 hypothetical protein CP001918.1.gene327.p Protein 4e-25 45
KPR_1323 YP_007990304.1 hypothetical protein BAC0560 Protein 8e-24 44
KPR_1323 YP_007990304.1 hypothetical protein NC_002695.1.917339.p Protein 8e-24 44
KPR_1323 YP_007990304.1 hypothetical protein CP000034.1.gene1596. Protein 7e-24 44
KPR_1323 YP_007990304.1 hypothetical protein NC_010558.1.6276025. Protein 4e-20 44
KPR_1323 YP_007990304.1 hypothetical protein CP001138.1.gene612.p Protein 7e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KPR_1323 YP_007990304.1 hypothetical protein VFG0585 Protein 6e-25 46
KPR_1323 YP_007990304.1 hypothetical protein VFG1038 Protein 4e-20 44