Gene Information

Name : pKPR_0128 (pKPR_0128)
Accession : YP_007988984.1
Strain :
Genome accession: NC_021231
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 110723 - 111025 bp
Length : 303 bp
Strand : -
Note : highly similar to transposase InsN for insertion sequence element IS911 from Shigella dysenteriae (sp|P39213)

DNA sequence :
ATGAAAAGAAGAAATTTTAGTCCTGAATTCAAACGCGAATCAGCTCAGTTGGTTGTCGATCAAAACTACACCGTCTCTGA
TGCCGCTAAGGCTATGGATGTTGGTCTTTCCACGATGACGAAATGGGTCAGGCAACTGCGTGAAGAACGTCAGGGCAAAA
CGCCAAAAGCCTCCCCGATAACGCCGGAACAAATCGAAATACGCGAGCTGAAGAAAAAGCTCCAACGTATTGAAATGGAA
AACGATATACTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAATTCTCGTTAA

Protein sequence :
MKRRNFSPEFKRESAQLVVDQNYTVSDAAKAMDVGLSTMTKWVRQLREERQGKTPKASPITPEQIEIRELKKKLQRIEME
NDILKKATALLMSDSLNNSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-34 90
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-39 90
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-39 90
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 6e-39 89
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 82
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-32 82
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 82
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-32 82
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 82
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 82
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 82
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-32 82
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-28 66
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-25 63
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-25 63
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-24 61
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-24 61
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 5e-24 61
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 5e-24 61
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-22 56
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-20 48
tnpA CAB61575.1 transposase A Not tested HPI Protein 4e-20 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-13 44
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pKPR_0128 YP_007988984.1 hypothetical protein VFG1485 Protein 5e-40 90
pKPR_0128 YP_007988984.1 hypothetical protein VFG1123 Protein 7e-33 82
pKPR_0128 YP_007988984.1 hypothetical protein VFG1553 Protein 4e-29 66
pKPR_0128 YP_007988984.1 hypothetical protein VFG0784 Protein 1e-24 61
pKPR_0128 YP_007988984.1 hypothetical protein VFG1566 Protein 6e-14 44
pKPR_0128 YP_007988984.1 hypothetical protein VFG1521 Protein 9e-13 41