Gene Information

Name : yvcP (TL13_0637)
Accession : YP_007974992.1
Strain : Streptococcus suis TL13
Genome accession: NC_021213
Putative virulence/resistance : Virulence
Product : Two-component response regulator SA14-24
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 641855 - 642559 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAAATATTAATTGTAGATGATGAAAAACCAATCTCAGATATTATTAAGTTTAATATGACTCGTGAGGGATATGA
AGTTGTGACAGCTTTCGATGGACGTGAAGCCTTGGAAGTGTTTGAGGCTGAGTTTCCTGACATTGTCATTTTGGACTTGA
TGCTGCCAGAATTGGATGGACTGGAGGTTGCTCGAATGATTCGTAAGACCAGCAATGTTCCAATCTTGATGTTATCTGCT
AAAGATAGCGAATTTGATAAGGTTATCGGACTTGAAATAGGGGCGGATGATTATGTGACCAAGCCCTTCTCTAATCGCGA
ATTGCAGGCGCGTGTTAAGGCTCTTCTTCGCCGTAGTGAATTGGCAGAGACGCAGACAAATATTGAGTCAACAGGAACTC
CAGAGTTGGTGATTGGCGATTTGGTCATTCTGCCTGATGCGTTTGTCGCTAAGAAGCATGGCAAAGAGCTGGAGCTGACC
CATCGTGAGTTTGAATTGCTCCACCATCTGGCCAAACACTTAGGTCAGGTTATGACTCGAGAACATCTATTGGAAACAGT
TTGGGGTTATGATTACTTTGGTGATGTCCGCACGGTGGATGTAACGATTCGTCGTCTGCGTGAGAAAATTGAAGATGCAC
CAAGCAGACCAGAATACATTCTTACTCGTCGCGGAGTGGGATATTTTATAAAAGGAAATGATTAA

Protein sequence :
MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAEFPDIVILDLMLPELDGLEVARMIRKTSNVPILMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLRRSELAETQTNIESTGTPELVIGDLVILPDAFVAKKHGKELELT
HREFELLHHLAKHLGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDAPSRPEYILTRRGVGYFIKGND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_012469.1.7685629. Protein 1e-89 81
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_002952.2859905.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_009782.5559369.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_002951.3237708.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_002758.1121668.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_009641.5332272.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_013450.8614421.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_007622.3794472.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_007793.3914279.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_003923.1003749.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_002745.1124361.p0 Protein 1e-54 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 HE999704.1.gene2815. Protein 1e-53 54
yvcP YP_007974992.1 Two-component response regulator SA14-24 AE016830.1.gene1681. Protein 1e-48 48
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_012469.1.7686381. Protein 3e-47 48
yvcP YP_007974992.1 Two-component response regulator SA14-24 FJ349556.1.orf0.gene Protein 2e-40 45
yvcP YP_007974992.1 Two-component response regulator SA14-24 AF155139.2.orf0.gene Protein 4e-40 45
yvcP YP_007974992.1 Two-component response regulator SA14-24 AM180355.1.gene1830. Protein 4e-40 44
yvcP YP_007974992.1 Two-component response regulator SA14-24 HE999704.1.gene1528. Protein 1e-35 43
yvcP YP_007974992.1 Two-component response regulator SA14-24 CP000034.1.gene3834. Protein 2e-33 43
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_002695.1.915041.p Protein 2e-33 43
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_014475.1.orf0.gen Protein 1e-38 43
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_005054.2598277.p0 Protein 1e-38 43
yvcP YP_007974992.1 Two-component response regulator SA14-24 DQ212986.1.gene4.p01 Protein 2e-38 43
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_002952.2859858.p0 Protein 2e-39 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_007622.3794948.p0 Protein 2e-39 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_003923.1003417.p0 Protein 2e-39 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_013450.8614146.p0 Protein 2e-39 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_002951.3238224.p0 Protein 2e-39 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_007793.3914065.p0 Protein 2e-39 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_002758.1121390.p0 Protein 2e-39 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 NC_010079.5776364.p0 Protein 2e-39 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 CP000647.1.gene4257. Protein 1e-32 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 CP001138.1.gene4273. Protein 2e-32 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 BAC0533 Protein 1e-32 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 AF162694.1.orf4.gene Protein 4e-35 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 CP001918.1.gene5135. Protein 7e-28 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 AE000516.2.gene3505. Protein 2e-36 42
yvcP YP_007974992.1 Two-component response regulator SA14-24 AE015929.1.gene1106. Protein 7e-34 41
yvcP YP_007974992.1 Two-component response regulator SA14-24 CP004022.1.gene3215. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yvcP YP_007974992.1 Two-component response regulator SA14-24 VFG1563 Protein 6e-38 45
yvcP YP_007974992.1 Two-component response regulator SA14-24 VFG1702 Protein 9e-38 44
yvcP YP_007974992.1 Two-component response regulator SA14-24 VFG1389 Protein 7e-32 43