Gene Information

Name : GBS222_1623 (GBS222_1623)
Accession : YP_007969280.1
Strain : Streptococcus agalactiae 2-22
Genome accession: NC_021195
Putative virulence/resistance : Virulence
Product : two-component response regulator (PhoB)
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1689097 - 1689774 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGATATATTGTGTTGAAGATGATGCTGATATTCGCGAAATGATGCTCTATACTTTGCAAATGGCAGGTTTTAAAGCTCA
AGGATTCTCGAGTTCAGAGCTTTTTTGGGAAGCTATTCAGGAGAAAGTTCCAGACTTGATTTTGCTTGATATTATGTTGC
CGGGAGATGATGGTTTGACTATTTTAGAGCGTTTAAGGAGAAAACATCAAACGGAAATGATACCAGTAATCATGACAACT
GCTAAAGGTAGTGAGTATGGTAAAGTTAAAGGGTTAGATCTTGGAGCAGATGATTATCTCGTCAAACCTTTTGGGATGAT
GGAAATGATTTCACGAATAAAAGCAGTCTTGAGACGTAGCCGCCAAGTAGATTCAAAAGCTCATATTATCATTGGAAATT
TAGAGATTGACCCGACTAATTATTGGGTCAAAAGGGGAACGGAAAAAATCCACTTAACCCTAAAGGAATTTGAGTTATTA
GTATTATTCTTCCGTAATCCCAATAGAGTCTTTACAAGGCAAGAACTTCTGGATAAGGTTTGGGGAGAACAATTTTTAGG
AGAAACTAGAACTGTGGATGTTCACATTGGGACACTGCGAACAAAACTTGGTGAGGATGGCTATTTGATCGCTACAGTAA
GGGGAGTTGGATACCGTTTGGAGGAAAGACACGACTAA

Protein sequence :
MIYCVEDDADIREMMLYTLQMAGFKAQGFSSSELFWEAIQEKVPDLILLDIMLPGDDGLTILERLRRKHQTEMIPVIMTT
AKGSEYGKVKGLDLGADDYLVKPFGMMEMISRIKAVLRRSRQVDSKAHIIIGNLEIDPTNYWVKRGTEKIHLTLKEFELL
VLFFRNPNRVFTRQELLDKVWGEQFLGETRTVDVHIGTLRTKLGEDGYLIATVRGVGYRLEERHD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-27 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-26 45
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 7e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) BAC0197 Protein 8e-31 46
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_003923.1003417.p0 Protein 2e-28 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_013450.8614146.p0 Protein 2e-28 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_002951.3238224.p0 Protein 2e-28 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_007793.3914065.p0 Protein 2e-28 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_002758.1121390.p0 Protein 2e-28 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) AE015929.1.gene1106. Protein 1e-22 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_010079.5776364.p0 Protein 2e-28 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_002952.2859858.p0 Protein 2e-28 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_007622.3794948.p0 Protein 2e-28 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) BAC0125 Protein 2e-27 45
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) BAC0308 Protein 1e-26 43
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) HE999704.1.gene1528. Protein 2e-20 43
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) BAC0111 Protein 5e-29 42
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_002952.2859905.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_009782.5559369.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_002951.3237708.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_002758.1121668.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_009641.5332272.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_013450.8614421.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_007793.3914279.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_003923.1003749.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_007622.3794472.p0 Protein 1e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_002745.1124361.p0 Protein 2e-38 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) AE000516.2.gene3505. Protein 1e-29 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_009085.4919120.p0 Protein 1e-25 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) CP001918.1.gene5135. Protein 9e-22 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) BAC0347 Protein 1e-27 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_010410.6002907.p0 Protein 1e-25 41
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) NC_011586.7046392.p0 Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GBS222_1623 YP_007969280.1 two-component response regulator (PhoB) VFG0596 Protein 2e-27 45