Gene Information

Name : tcrA (L083_3909)
Accession : YP_007951899.1
Strain : Actinoplanes sp. N902-109
Genome accession: NC_021191
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4619457 - 4620134 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence : 
GTGCGGCTCCTGGTGGTGGAAGACGAGCGGGAACTGGCCGAGTCCCTGCGTCGCGGCCTGACGGCGGAGGGCTATACCGT
TGATGTGGCCCACGACGGGGTCAGCGGGCTGGACCTGGCGCTGAGCGAGGGCTATCAGGCGGTCATCCTGGACCTGATGC
TGCCGCGGATGAACGGCTACCGGGTGTGCGCCCGGATGCGGGAGCTGCGGGTCGGCACGCCGGTGCTGGTCCTGACCGCC
AAGGACGGCGAGTACGACGAGGCGGAGGCCCTGGACACCGGGGCGGACGACTATCTGACCAAGCCCTTCTCGTACGTCGT
CCTGCTGGCCCGGGTACGGGCCCTGCTGCGCCGTGGTGGTGCGCCCCGCCCGGCCGTGCTGACGGTCGGCGATCTGGTGG
TCGATCAGGCCCGGCGGGTCTGTGCGCGCGGCTCGGCGCCGATCCCGCTGACCGCCAAGCAGTTCGCGGTGCTGGCCTGC
CTGGCCCGGCGGGCGAACATGGTGGTGAGCAAGGCGGAGATCCTGGACGAGGTGTGGGACGCGGCCTACGCCGGCGACCT
GAACATCGTCGAGGTCTACATCCGGGCCCTGCGCCGCCGCATCGACGTGCCGTTCGGCCTGCTGAGCATCGAGACCGTCC
GCGGCGCCGGCTACCGGCTGGTCGACGCGCATGCCTAG

Protein sequence : 
MRLLVVEDERELAESLRRGLTAEGYTVDVAHDGVSGLDLALSEGYQAVILDLMLPRMNGYRVCARMRELRVGTPVLVLTA
KDGEYDEAEALDTGADDYLTKPFSYVVLLARVRALLRRGGAPRPAVLTVGDLVVDQARRVCARGSAPIPLTAKQFAVLAC
LARRANMVVSKAEILDEVWDAAYAGDLNIVEVYIRALRRRIDVPFGLLSIETVRGAGYRLVDAHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-34 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-33 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein BAC0197 Protein 8e-34 46
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein BAC0125 Protein 2e-33 44
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein BAC0638 Protein 5e-27 43
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein BAC0083 Protein 4e-32 43
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein BAC0308 Protein 1e-31 43
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein AE015929.1.gene1106. Protein 1e-26 41
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein U82965.2.orf14.gene. Protein 4e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein VFG0596 Protein 2e-34 46
tcrA YP_007951899.1 two component transcriptional regulator, winged helix family protein VFG1390 Protein 2e-34 41