Gene Information

Name : Desgi_0944 (Desgi_0944)
Accession : YP_007944165.1
Strain : Desulfotomaculum gibsoniae DSM 7213
Genome accession: NC_021184
Putative virulence/resistance : Resistance
Product : putative stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 966236 - 966808 bp
Length : 573 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
TTGGCGGTTAATTTACAAAAGGGACAAAAGGTGGATTTAACGAAAGGTAGACCCGGACTTTCCAAGGTTATTGCCGGTCT
GGGGTGGGATACCAATAAATTTGACGGTCCCGACTTTGATTTAGATGCATCGGCTTTTCTGTTGGGTGAGAACGGTAAAT
GCGCCAGTGCCGATGACTTTGTATTTTATAATAACTTAAAGCACGCCAGCGGTTCTGTCGAGCATTTAGGGGACAACCTT
ACCGGTGAGGGCGAAGGTGATGATGAGCAAATTAAAATTGATTTAAGTAAAGTGCCCGCTCATGTTCACAAAATTGCCCT
TACTGTGACCATTCACATGGCCAGTGAGCGCAACCAGAATTTTGGTTTGGTATCCAACGCCTTTGTCCGCATAGTGGACG
AAAACTCAGGCGCGGAACTACTGCGTTACGACCTCAGTGAGGATTATAGTATTGAGACTGCTCTGGTGTTTGCAGAGCTT
TACCGGCATGGTGCAGAGTGGAAGTTTGCCGCTGTAGGCCAGGGATTTAATGACGGATTGGCTGGTCTGGTACGCTTGTA
TGGTTTGGAATAA

Protein sequence :
MAVNLQKGQKVDLTKGRPGLSKVIAGLGWDTNKFDGPDFDLDASAFLLGENGKCASADDFVFYNNLKHASGSVEHLGDNL
TGEGEGDDEQIKIDLSKVPAHVHKIALTVTIHMASERNQNFGLVSNAFVRIVDENSGAELLRYDLSEDYSIETALVFAEL
YRHGAEWKFAAVGQGFNDGLAGLVRLYGLE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-56 61
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 57
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-49 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-51 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-47 54
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-26 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desgi_0944 YP_007944165.1 putative stress response protein, TerZ- and CABP1 BAC0390 Protein 7e-54 60
Desgi_0944 YP_007944165.1 putative stress response protein, TerZ- and CABP1 BAC0389 Protein 4e-51 57