Gene Information

Name : Desgi_3179 (Desgi_3179)
Accession : YP_007946210.1
Strain : Desulfotomaculum gibsoniae DSM 7213
Genome accession: NC_021184
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3216272 - 3216646 bp
Length : 375 bp
Strand : -
Note : PFAM: Penicillinase repressor; TIGRFAM: copper transport repressor, CopY/TcrY family

DNA sequence : 
TTGAGTATCCCCAAAATATCTGACTCAGAATGGGAAATCATGAAAGTGATATGGAAGAGAAATTCAATAACATCTGAAGA
AATAATCGCCTCTCTGTCTGAAAAAAAAGACTGGTCGCCCCAAACCATAAAAACATTTATCAACCGACTGCTTAAAAAAG
GCGCCATAAGACATAAAAAAAACGGCCGGAGCTATATATATTATCCAGCCATATCTGAGAAGGAATGCGTGCTGGCCGAA
AGCAAAAGTTTTATTAAAAGGGTGTACGACGGCGCGACAGCAATGTTTTTTGTCAACTTTCTTGAGGAAAAGGTTTTGTC
CGAGGAAGAAATTGCCAAGCTTCAAAACATATTAGAAGATAAAAAACGTAAGTAG

Protein sequence : 
MSIPKISDSEWEIMKVIWKRNSITSEEIIASLSEKKDWSPQTIKTFINRLLKKGAIRHKKNGRSYIYYPAISEKECVLAE
SKSFIKRVYDGATAMFFVNFLEEKVLSEEEIAKLQNILEDKKRK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mecI NP_370567.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 8e-21 43
mecI NP_373280.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 4e-21 43
mecI YP_190060.1 methicillin-resistance regulatory protein MecI Not tested Type-II SCCmec Protein 4e-21 43
mecI BAA82218.1 methicillin resistance protein MecI Not tested Type-II SCCmec Protein 3e-21 43
mecI YP_039517.1 methicillin resistance regulatory protein MecI Not tested Type-II SCCmec Protein 8e-19 42
mecI YP_005754043.1 methicillin resistance regulatory protein MecI Not tested Type-XI SCCmec Protein 1e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desgi_3179 YP_007946210.1 putative transcriptional regulator CP001581.1.gene771.p Protein 5e-28 48
Desgi_3179 YP_007946210.1 putative transcriptional regulator AM180355.1.gene595.p Protein 4e-24 44
Desgi_3179 YP_007946210.1 putative transcriptional regulator NC_009782.5560220.p0 Protein 2e-21 43
Desgi_3179 YP_007946210.1 putative transcriptional regulator NC_002758.1120003.p0 Protein 2e-21 43
Desgi_3179 YP_007946210.1 putative transcriptional regulator NC_002745.1122814.p0 Protein 1e-21 43
Desgi_3179 YP_007946210.1 putative transcriptional regulator NC_002952.2861158.p0 Protein 2e-19 42
Desgi_3179 YP_007946210.1 putative transcriptional regulator FR823292.1.gene6.p01 Protein 3e-21 42