Gene Information

Name : LA14_0082 (LA14_0082)
Accession : YP_007936992.1
Strain : Lactobacillus acidophilus La-14
Genome accession: NC_021181
Putative virulence/resistance : Virulence
Product : Two-component response regulator SA14-24
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 79915 - 80631 bp
Length : 717 bp
Strand : +
Note : -

DNA sequence :
ATGCCAAAAAAAATTCTCGTCGTCGACGATGAAAAGCCTATTTCCGATATTATCAAATTTAATTTAACTAAGGAAGGCTT
TGACGTCGACACTGCCTATGATGGCGAAGAAGCTGTTAAAAAAGTTGACGAATACGACCCAGATCTAATGATCTTGGATT
TAATGTTGCCAAAAAAGGATGGACTAGAGGTTGCTCGTGAAGTCCGTCAAACGCATGATATGCCAATTATTATGGTAACT
GCAAAAGATACTGAAATCGATAAAGTTTTAGGACTCGAAATGGGTGCGGATGATTACGTAACTAAACCATTTTCTAACCG
TGAATTAGTTGCTCGGGTTAAGGCTAACTTACGTCGCCGCGATATTGTTAAAAAAGCAGAAGCTGCAAATCAAGAAGAAC
CCGATAAGAATATTAAGATCGGTAATTTGGTTATCATGCCTGATGCCTATATTGTAGAAAAGAATGGTAAGAAGATTGAA
CTTACACATCGTGAATTTGAACTTCTTTACTATTTAGCTCAACATATGGGCCAAGTTATGACACGTGAACATTTATTACA
AACTGTTTGGGGTTATGACTACTTTGGTGATGTACGTACTGTTGATGTAACTGTTCACCGTTTGAGAGAAAAGATTGAGG
ATAACCCAATTCAACCTCAAATTTTGGTTACTCGTCGTGGTGTCGGCTACTATGTAAAACAGCCAAGTGAAGGATAA

Protein sequence :
MPKKILVVDDEKPISDIIKFNLTKEGFDVDTAYDGEEAVKKVDEYDPDLMILDLMLPKKDGLEVAREVRQTHDMPIIMVT
AKDTEIDKVLGLEMGADDYVTKPFSNRELVARVKANLRRRDIVKKAEAANQEEPDKNIKIGNLVIMPDAYIVEKNGKKIE
LTHREFELLYYLAQHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVHRLREKIEDNPIQPQILVTRRGVGYYVKQPSEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_012469.1.7685629. Protein 6e-66 65
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_003923.1003749.p0 Protein 3e-50 54
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_002952.2859905.p0 Protein 3e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_002745.1124361.p0 Protein 4e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_009782.5559369.p0 Protein 4e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_002951.3237708.p0 Protein 4e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_002758.1121668.p0 Protein 4e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_007622.3794472.p0 Protein 3e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_009641.5332272.p0 Protein 4e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_013450.8614421.p0 Protein 4e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_007793.3914279.p0 Protein 4e-50 53
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 HE999704.1.gene2815. Protein 5e-43 52
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_012469.1.7686381. Protein 8e-39 46
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 AE000516.2.gene3505. Protein 2e-33 45
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_002695.1.915041.p Protein 5e-33 44
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 CP000034.1.gene3834. Protein 5e-33 44
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 CP001918.1.gene5135. Protein 2e-28 44
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 AE016830.1.gene1681. Protein 3e-38 43
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 CP001138.1.gene4273. Protein 1e-32 43
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 BAC0533 Protein 8e-33 43
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 CP000647.1.gene4257. Protein 8e-33 43
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 AF155139.2.orf0.gene Protein 1e-34 43
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 FJ349556.1.orf0.gene Protein 1e-34 43
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_010079.5776364.p0 Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_002952.2859858.p0 Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_007622.3794948.p0 Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 AE015929.1.gene1106. Protein 6e-27 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_003923.1003417.p0 Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_013450.8614146.p0 Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_002951.3238224.p0 Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_007793.3914065.p0 Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_002758.1121390.p0 Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_014475.1.orf0.gen Protein 4e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 AF162694.1.orf4.gene Protein 2e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_005054.2598277.p0 Protein 4e-33 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 CP004022.1.gene3215. Protein 3e-31 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 AM180355.1.gene1830. Protein 7e-34 41
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 DQ212986.1.gene4.p01 Protein 2e-33 41
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_010410.6002989.p0 Protein 1e-23 41
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_010400.5986590.p0 Protein 7e-23 41
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 NC_011595.7057856.p0 Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 VFG1563 Protein 3e-32 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 VFG1702 Protein 3e-32 42
LA14_0082 YP_007936992.1 Two-component response regulator SA14-24 VFG1389 Protein 4e-29 41