Gene Information

Name : LA14_1660 (LA14_1660)
Accession : YP_007938490.1
Strain : Lactobacillus acidophilus La-14
Genome accession: NC_021181
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1680846 - 1681547 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
ATGGATGAAAAAGATGTCAAAATTCTCTTAGTAGAAGATGAAGAAGCCGTAGCCAGCTTCGTTAAAACTGAACTAGAATT
TGAAGGTTACCAAGTAATTTGGGCTCAAGATGGCAAAGAAGCTTTAGAACTCTTTCAAAAAGAAAAACCCACTTTAATCC
TGCTCGACTGGATGCTTCCTGTATATGATGGGATCACTGTTTTAAGACGGATTCGTAAAAAAAGCGAGGTCCCTATTATT
ATGCTTACTGCTAAAAATTCCACTTCTGACATTAGCTCAGCCCTTGATCAAGGATTAGATGACTATATTACTAAGCCATT
TGAAATTGAAGAACTTTTTGCTAGAATTCGAGTAATTTTGCGTCGCTTAGAAAAAAGTAACAAACAAAAAGAAAACTCGA
CAATTTCATTTAACTTTGGACCTTTTAAAATTGATTTGGTTAAACACGAATTCTTCTCTAATGATGAAAAAATCTATTTG
ACTCCAAAGGAATTTGCTCTAATGACTGAATTAATGCGTGACCCGGAAAAAGTCAAAAGCCGCGATGAATTGCTTGATGT
AGTCTGGGGATATGACTTTGTGGGGCAAACTAACACAGTTGATGTCTATATCAGAACCATCCGGAATAAAATAGGTGATC
CTAATAAAAAGTTAATTCAGACTGTCCGTGGATTAGGGTATTGTTTAAGAAAAGCCGAATAA

Protein sequence :
MDEKDVKILLVEDEEAVASFVKTELEFEGYQVIWAQDGKEALELFQKEKPTLILLDWMLPVYDGITVLRRIRKKSEVPII
MLTAKNSTSDISSALDQGLDDYITKPFEIEELFARIRVILRRLEKSNKQKENSTISFNFGPFKIDLVKHEFFSNDEKIYL
TPKEFALMTELMRDPEKVKSRDELLDVVWGYDFVGQTNTVDVYIRTIRNKIGDPNKKLIQTVRGLGYCLRKAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LA14_1660 YP_007938490.1 two-component system response regulator HE999704.1.gene1528. Protein 6e-34 44
LA14_1660 YP_007938490.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-36 44
LA14_1660 YP_007938490.1 two-component system response regulator AE015929.1.gene1106. Protein 3e-30 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_002952.2859905.p0 Protein 9e-37 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-36 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-36 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-36 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-36 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-36 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-36 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-36 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-36 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_003923.1003749.p0 Protein 9e-37 43
LA14_1660 YP_007938490.1 two-component system response regulator NC_002952.2859858.p0 Protein 9e-34 42
LA14_1660 YP_007938490.1 two-component system response regulator NC_007622.3794948.p0 Protein 9e-34 42
LA14_1660 YP_007938490.1 two-component system response regulator NC_003923.1003417.p0 Protein 9e-34 42
LA14_1660 YP_007938490.1 two-component system response regulator NC_013450.8614146.p0 Protein 9e-34 42
LA14_1660 YP_007938490.1 two-component system response regulator NC_002951.3238224.p0 Protein 9e-34 42
LA14_1660 YP_007938490.1 two-component system response regulator NC_007793.3914065.p0 Protein 9e-34 42
LA14_1660 YP_007938490.1 two-component system response regulator NC_002758.1121390.p0 Protein 9e-34 42
LA14_1660 YP_007938490.1 two-component system response regulator NC_010079.5776364.p0 Protein 9e-34 42
LA14_1660 YP_007938490.1 two-component system response regulator FJ349556.1.orf0.gene Protein 2e-32 42
LA14_1660 YP_007938490.1 two-component system response regulator AF155139.2.orf0.gene Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LA14_1660 YP_007938490.1 two-component system response regulator VFG0596 Protein 3e-31 41