Gene Information

Name : SFUL_86 (SFUL_86)
Accession : YP_007928956.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 83280 - 83855 bp
Length : 576 bp
Strand : +
Note : UniProt-pubmed:11572948; gene_name:terD2; gene_name:terD1; gene_name:terD; gene_name:terD5; UniProt-pubmed:18375553; UniProt-pubmed:20581206; UniProt-pubmed:12000953; UniProt-pubmed:20064060; UniProt-pubmed:16632251; Uncharacterized proteins involved in s

DNA sequence :
ATGGGTGTGAGCCTGGCGAAGGGCGGCAACGTCTCCCTGTCGAAGGAGGCCCCCGGCCTGACGGCCGTGACGGTCGGCCT
CGGCTGGGACGTACGGACCACGACCGGAGCCGATCACGACCTGGATGCCAGTGCGCTGCTGTGCTCCGAGGCGGGCAAGG
TCCTCTCCGACGGCCATTTCGTCTTCTACAACAACCTCACCAGTCCCGACGGTTCGGTCCGCCACACCGGGGACAACCTG
ACGGGTGAGGGCGAGGGGGACGACGAGTCGGTCGAGGTCGACCTGGCCTCGGTCCCCGCCGAGATCGCGAAGATCGTGTT
CCCGGTCTCGATCCATGACGCCCAGAGCCGGGGCCAGAGCTTCGGCCAGGTGCGCAACGCCTTCATCCGCGTGGTGAACC
GGGCGAACGGTGTCGAGCTGGCCCGCTACGACCTGAGCGAGGACGCCTCCACCGAGACCGCGATGGTCTTCGGCGAGCTC
TACCGGCACGGCGCCGAGTGGAAGTTCCGGGCCGTCGGCCAGGGGTACGCATCGGGGCTCGCCGGCATCGCGTCCGACTA
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLAKGGNVSLSKEAPGLTAVTVGLGWDVRTTTGADHDLDASALLCSEAGKVLSDGHFVFYNNLTSPDGSVRHTGDNL
TGEGEGDDESVEVDLASVPAEIAKIVFPVSIHDAQSRGQSFGQVRNAFIRVVNRANGVELARYDLSEDASTETAMVFGEL
YRHGAEWKFRAVGQGYASGLAGIASDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-54 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-54 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-54 68
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-52 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-52 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-52 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-54 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-52 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 8e-24 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-19 41
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_86 YP_007928956.1 tellurium resistance protein BAC0390 Protein 4e-56 68
SFUL_86 YP_007928956.1 tellurium resistance protein BAC0389 Protein 3e-53 67
SFUL_86 YP_007928956.1 tellurium resistance protein BAC0392 Protein 1e-19 41