Gene Information

Name : SFUL_653 (SFUL_653)
Accession : YP_007929522.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 766542 - 767117 bp
Length : 576 bp
Strand : +
Note : UniProt-pubmed:11572948; gene_name:terD2; UniProt-pubmed:16632251; UniProt-pubmed:20581206; UniProt-pubmed:18375553; gene_name:terD; UniProt-pubmed:12000953; UniProt-pubmed:20064060; gene_name:terD1; Uncharacterized proteins involved in stress response, h

DNA sequence :
ATGGGCGTGAGCCTGGCCAAGGGCGGAAATGTCTCGCTGACCAAGGAGGCCCCGGGGCTGACCGCGATCCTCGTCGGTCT
CGGCTGGGACGTCCGCACGACGACCGGTACCGACTACGACCTCGACGCGAGCGCGCTGCTCTGCGACGAGTCGGGCAAGG
TCCTCTCCGACGGGCACTTCGTCTTCTACAACAACCTCAAGAGCCCGGACGGTTCGGTCGAGCACACCGGCGACAACCTC
ACGGGTGAGGGCGAGGGGGACGACGAGATCGTCAAGGTCGACCTCTCCGCGGTGCCGGGAACCGTCGCCAAGATCGTGTT
CCCCGTCTCGATCCATGAGGCGGAGGGCCGCGGCCAGAGCTTCGGCCAGGTCCGCAACGCCTACATCCGCGTGGTGAACC
AGGCGGGCGGCGCGGAGATCGCCCGTTACGACCTCAGCGAGGACGCCTCCACCGAGACGGCGATGGTCTTCGGCGAGCTG
TACCGGCACGGCGCCGAGTGGAAGTTCCGTGCGGTCGGGCAGGGTTACGCCTCCGGGCTGAGCGGCATCGTCGCCGACTT
CGGCGTCGGTCTCTGA

Protein sequence :
MGVSLAKGGNVSLTKEAPGLTAILVGLGWDVRTTTGTDYDLDASALLCDESGKVLSDGHFVFYNNLKSPDGSVEHTGDNL
TGEGEGDDEIVKVDLSAVPGTVAKIVFPVSIHEAEGRGQSFGQVRNAYIRVVNQAGGAEIARYDLSEDASTETAMVFGEL
YRHGAEWKFRAVGQGYASGLSGIVADFGVGL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-62 68
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-60 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-60 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-60 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-58 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-58 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-27 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-27 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_653 YP_007929522.1 tellurium resistance protein BAC0390 Protein 8e-63 66
SFUL_653 YP_007929522.1 tellurium resistance protein BAC0389 Protein 3e-60 66
SFUL_653 YP_007929522.1 tellurium resistance protein BAC0392 Protein 3e-26 41